Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_043920347.1 jaqu_RS17725 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >NCBI__GCF_000877395.1:WP_043920347.1 Length = 251 Score = 105 bits (261), Expect = 1e-27 Identities = 79/250 (31%), Positives = 118/250 (47%), Gaps = 8/250 (3%) Query: 18 RYPS--LVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKP 75 R PS L R + GG+ G+G A GA V A A EA A + ++ H Sbjct: 5 RTPSFRLEGRRAFVPGGSRGLGLGCAVALAEAGAEVVIAARSADAVEAAAAAMREAGHAA 64 Query: 76 LFLSCDLTDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRESFDAGIAVNIRH 135 ++ D+TD+ A+ A D +A P +L N A + E + FDA A+N+R Sbjct: 65 TGVALDVTDLAAVD-AFLDGEA---PFDILCNAAGVARHGPALETEPDDFDAVAALNLRA 120 Query: 136 QFFAAQAVMEDMKAANSGSIINLGSISWMLKNGGYPVYVMSKSAVQGLTRGLARDLGHFN 195 +F AQ V M GSII + S + VY +K V+G+T+ +A + G + Sbjct: 121 AYFLAQRVARGMD--RGGSIIQISSQMGHVGGVDRAVYCATKHGVEGMTKAMAIEWGPRD 178 Query: 196 IRVNTLVPGWVMTEKQKRLWLDDAGRRSIKEGQCIDAELEPADLARMALFLAADDSRMIT 255 IRVNT+ P ++ T + D R I E + E D+ +FLA++ S M+T Sbjct: 179 IRVNTICPTFIRTPLTAATFADPERRAWIDEKIKLPRVGEVEDIMGAVVFLASEASAMVT 238 Query: 256 AQDIVVDGGW 265 ++VDGGW Sbjct: 239 GTSLLVDGGW 248 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 251 Length adjustment: 24 Effective length of query: 242 Effective length of database: 227 Effective search space: 54934 Effective search space used: 54934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory