Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate WP_043917498.1 jaqu_RS03160 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21653 (298 letters) >NCBI__GCF_000877395.1:WP_043917498.1 Length = 312 Score = 132 bits (333), Expect = 8e-36 Identities = 87/273 (31%), Positives = 146/273 (53%), Gaps = 7/273 (2%) Query: 17 WLFVAPALGLITLFMVYPIAWSLWMSFQSGRGMTLKFAGFANIVRLWNDPVFIKALTNTM 76 +L VAPA+ + +YP +++ SF + + + GF N VRL D F AL NT Sbjct: 35 YLLVAPAVIYLLGITLYPGIYAIIQSFHAVKFGPWQPVGFDNYVRLMGDYQFWGALWNTF 94 Query: 77 TYFVVQVPIMILLALILASLL-NNPRLVGRGVFRTAIFLPCVSSLVAYSVLFKGMFATDG 135 + + + +LALILA +P + G +R +P + A + ++K F Sbjct: 95 VIGSISLTLQCVLALILAFYAYRDPWVQG---WRIVFLVPMLFMPSAVAFIYKLSFLDAR 151 Query: 136 IVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLAALQNIDKSIYEVA 195 + + LQ IGL + + + ++ L+ILA W+WT + I ++AALQ D+ + E A Sbjct: 152 VFSDLLQRIGLIDGNLAIQSSVWGSRALLILADVWQWTPFLFIIFVAALQGQDEEVEEAA 211 Query: 196 RIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEGKGGPSNATLTLSL 255 R+DG ++ ++++PL+KPVI ++ I +F V+ +T KGGP+ T T+S Sbjct: 212 RLDGASWFSIFWNISLPLMKPVIAVALILRGIDITTMFTNVFIIT--KGGPAFGTETISY 269 Query: 256 YIYNLTFRFMPNLGYAATVSYVIVVLVALLAFV 288 +IY F+F N GYA+ S V+++L ++A V Sbjct: 270 FIYRTGFKFF-NFGYASAASVVMLILTIIIAQV 301 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 312 Length adjustment: 27 Effective length of query: 271 Effective length of database: 285 Effective search space: 77235 Effective search space used: 77235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory