Align LacK, component of Lactose porter (characterized)
to candidate WP_043916916.1 jaqu_RS00215 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_000877395.1:WP_043916916.1 Length = 372 Score = 323 bits (828), Expect = 5e-93 Identities = 182/353 (51%), Positives = 237/353 (67%), Gaps = 12/353 (3%) Query: 1 MAEVRLTDIRKSYGS-LEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGE 59 MA ++L D+ K YG +EV+K ++L++ +GE +VFVGPSGCGKSTLLRMIAGLE IS G Sbjct: 1 MANLKLKDVAKVYGGQVEVLKDIDLDIETGELIVFVGPSGCGKSTLLRMIAGLEQISGGT 60 Query: 60 LTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119 L I G V+NDV PS+RGIAMVFQ+YALYPHMTV +NM FAL+ A +K+EI+R V AAA Sbjct: 61 LEIDGMVVNDVPPSERGIAMVFQSYALYPHMTVYDNMAFALQIAKKSKEEIDRAVRAAAD 120 Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179 L+L +DR PKALSGGQRQRVAIGR+IVR P V+LFDEPLSNLDA LRV R+EIA+L Sbjct: 121 KLQLTEYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRIEIAQL 180 Query: 180 HKEL-NATIVYVTHDQVEAMTLADKIVVMRG-------GIVEQVGAPLALYDDPDNMFVA 231 +++ ++T++YVTHDQVEAMTLA +IVV+ + QVG PL LY+ P++ FVA Sbjct: 181 KEQMPDSTMIYVTHDQVEAMTLASRIVVLDALKDNGYKYSIAQVGTPLELYETPNSEFVA 240 Query: 232 GFIGSPRMNFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHFL 291 FIGSP MN L ++ A G T+ + T + + P G V VG+RPE + Sbjct: 241 RFIGSPAMNLLEGEIV--ATGETTTLRTRLGAGTITSNVPSRPEDQGAQVKVGIRPEDAV 298 Query: 292 PAGSGDTQLTAHVDVVEHLGNTSYVYAHTVPGE-QIIIEQEERRHGGRYGDEI 343 S D + V+V E LG + +Y G+ +I + H G G+ + Sbjct: 299 ATDSEDFAFSGKVEVEERLGEVTLLYFERGAGQNDPVIAKLPGIHPGMRGNTV 351 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 372 Length adjustment: 30 Effective length of query: 333 Effective length of database: 342 Effective search space: 113886 Effective search space used: 113886 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory