Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate WP_043919090.1 jaqu_RS11405 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P22256 (426 letters) >NCBI__GCF_000877395.1:WP_043919090.1 Length = 464 Score = 154 bits (390), Expect = 4e-42 Identities = 128/422 (30%), Positives = 202/422 (47%), Gaps = 39/422 (9%) Query: 34 RVWDVEGREYLD-FAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEI 92 RVWD G+E+LD +GG+ +N G+ ++ AV QL K+++ Q L P E Sbjct: 45 RVWDQHGKEHLDAVSGGVWTVNVGYGRTEIADAVRDQLVKMNYFA-QTLGSIPGSLFAER 103 Query: 93 MNQKVPGDFAKKTLLVTTGSEAVENAVKIAR--AATKRSGT----IAFSGAYHGRTHYTL 146 + K+PG + +GSEA E A K+ R A T+ G + YHG T + Sbjct: 104 LLDKMPG--LSRVFYTNSGSEANEQAFKMIRQIAQTRHGGKKWKILYRDRDYHGTTIGCM 161 Query: 147 ALTGK------VNPYSAGMGLMPGHVYRALYPCPLHGISEDD----AIASIHRIFKNDAA 196 + G+ P++ G +P + + +S +D A +I + + Sbjct: 162 SAGGQDERNEQYGPFAPGFVRVPHCLEYRKHDQGWGDLSGEDYGRRAADAIEEVILAEG- 220 Query: 197 PEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQ 256 P+ + AI +EP+ GG P + +R++ + D++ ++L DEV G GRTGT F + Sbjct: 221 PDTVGAICLEPITAGGGVIVPPPGYWERVQEIVDKYDLILHIDEVVCGIGRTGTWFGYQH 280 Query: 257 MGVAPDLTTFAKSIAGGF-PLAGVTGRAEVMDAV--APGG------LGGTYAGNPIACVA 307 GV PD+ T AK +A G+ ++ V EV D AP T+ G VA Sbjct: 281 YGVRPDIVTMAKGVASGYAAISCVATTEEVFDTFKSAPDDPMNFFRAVSTFGGCAAGPVA 340 Query: 308 ALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDGDHNK 367 AL+ +++ E E+LL+ +G++L D L A+AE+H IGDVRG G IEL D D + Sbjct: 341 ALKNMEIIETEDLLRNTQAMGERLLDNLHALAERHAAIGDVRGKGLFCGIELVADRDTRE 400 Query: 368 --PDAKLTAEIVARARDKGLILLSCG---PYYNVLRILVPLTIEDAQIRQGLEIISQCFD 422 P+A++ A I A +G ++ + P N + P I A ++ I+ D Sbjct: 401 PLPEAQVKA-IAADCMQQGYVIGASNRSVPKRNNCLLFSPALIATA---DDIDAITASVD 456 Query: 423 EA 424 EA Sbjct: 457 EA 458 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 464 Length adjustment: 32 Effective length of query: 394 Effective length of database: 432 Effective search space: 170208 Effective search space used: 170208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory