Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate WP_043917557.1 jaqu_RS03510 FAD-binding oxidoreductase
Query= BRENDA::Q8N465 (521 letters) >NCBI__GCF_000877395.1:WP_043917557.1 Length = 468 Score = 270 bits (689), Expect = 1e-76 Identities = 160/434 (36%), Positives = 233/434 (53%), Gaps = 7/434 (1%) Query: 91 DWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILST 150 DW R ++RP T+ EVS ++ LAV P GGNTG+VGG+ V +++S Sbjct: 31 DWTGKWRAQPLAVVRPATTREVSECVQLAARHCLAVVPVGGNTGLVGGTANV-GALMISL 89 Query: 151 ARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGG 210 RMNR+ + + + +AG +L +L +++D + PL GA+GS IGG ++TNAGG Sbjct: 90 ERMNRIREIRPAARLAIVEAGVILSDLHAAADDQDLVFPLTFGARGSAQIGGVLSTNAGG 149 Query: 211 LRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSI 270 +RYGS G LGLEVVLADG VLD ++ L KDN+G+DL+ LFIG+EGTLG+IT + Sbjct: 150 SNVVRYGSTRGLCLGLEVVLADGRVLDLMSELHKDNSGFDLRDLFIGAEGTLGLITAAIL 209 Query: 271 LCPPKPRAVNVAFLGCPGFAEVLQTFSTCKGMLGEILSAFEFMDAVCMQLVGRHL-HLAS 329 PKP+ A L G L + + + AFE+M M+ + H L Sbjct: 210 RLSPKPKHHATALLAVAGVPAALDLLNRLQLASEGAVEAFEYMPRSYMEALAEHRPDLKQ 269 Query: 330 PVQESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERI 389 P+ V++E G + + ++ L A+ G V D T+A + + KM+W +RE Sbjct: 270 PLGIHDHTVMLELGGLSR-NPTPQVEDILSGAIERGEVLDATVAQSETQRKMVWEMREAA 328 Query: 390 TEALSRDGYVYKYDLSLPVERLYDIVTDLRARLGPHAKHVVG---YGHLGDGNLHLNVTA 446 E + D+ LPV+R+ D + ++ ARL H G HLGDGN+HL + Sbjct: 329 AEITFTRLPIVDNDICLPVDRVADFIAEMEARL-THLDEGAGNLIVAHLGDGNVHLTLYP 387 Query: 447 EAFSPSLLAALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPGALQLMQQLKALLD 506 + P L L V + T G GS+SAEHG+G K + K P AL +M+ +K LD Sbjct: 388 TSDDPDHLDRLREMVEDVTVGLGGSISAEHGIGLSKLATMRRRKDPIALDVMRAIKNALD 447 Query: 507 PKGILNPYKTLPSQ 520 P +NP K +P + Sbjct: 448 PDNRMNPGKVVPPE 461 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 468 Length adjustment: 34 Effective length of query: 487 Effective length of database: 434 Effective search space: 211358 Effective search space used: 211358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory