Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate WP_043917837.1 jaqu_RS04975 3-oxoacyl-ACP reductase FabG
Query= SwissProt::Q6CEE9 (278 letters) >NCBI__GCF_000877395.1:WP_043917837.1 Length = 245 Score = 130 bits (327), Expect = 3e-35 Identities = 84/247 (34%), Positives = 132/247 (53%), Gaps = 8/247 (3%) Query: 29 FSLKGKVASITGSSSGIGFAVAEAFAQAGADVAIWYNSKPSDEKAEYLSKTYGVRSKAYK 88 F L GK A +TG+S GIG A+A GA V + S +E + L++ G R+ Sbjct: 2 FDLNGKAALVTGASGGIGAAIARTLHGRGATVGL---SGTREEPLKALAEELGERANVLP 58 Query: 89 CAVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVVDLDLNGAY 148 C +++A V + + G +DI + NAG+ T + + EEW +V++++L A+ Sbjct: 59 CNLSDADAVNALPKQAAEAMGAVDILVNNAGV--TRDNLFMRMSEEEWAQVIEVNLTAAF 116 Query: 149 YCAKYAGQIFKKQGYGSFIFTASMSGHIVNIPQMQACYNAAKCAVLHLSRSLAVEWAGFA 208 +K + K +G + +S+ G N Q Y A+K ++ +S+SLA E A Sbjct: 117 RLSKGVLRGMMKARWGRIVNVSSVVGATGN--PGQGNYAASKAGLVGMSKSLAYEVASRG 174 Query: 209 -RCNTVSPGYMATEISDFIPRDTKEKWWQLIPMGREGDPSELAGAYIYLASDASTYTTGA 267 N ++PG++AT ++D + D K K IPMGR G P E+A A +YLASD + Y TGA Sbjct: 175 ITVNAIAPGFIATAMTDKLTDDQKSKIDDQIPMGRMGTPEEIAAAALYLASDEAAYVTGA 234 Query: 268 DILVDGG 274 + V+GG Sbjct: 235 VLHVNGG 241 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 245 Length adjustment: 25 Effective length of query: 253 Effective length of database: 220 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory