Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_043919312.1 jaqu_RS12415 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000877395.1:WP_043919312.1 Length = 335 Score = 486 bits (1251), Expect = e-142 Identities = 253/331 (76%), Positives = 272/331 (82%), Gaps = 2/331 (0%) Query: 1 MGKITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQI 60 MG I L + K FG+ VIP LDL IE+GEF VFVGPSGCGKSTLLRLIAGLEDVS G I Sbjct: 1 MGHIKLNQITKSFGDVEVIPPLDLTIENGEFAVFVGPSGCGKSTLLRLIAGLEDVSSGHI 60 Query: 61 MIDGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKI 120 IDGRD T++PPAKRGLAMVFQSYALYPHM+V+KNIAFPL MA M+ E +RRV AA + Sbjct: 61 EIDGRDVTDVPPAKRGLAMVFQSYALYPHMSVRKNIAFPLHMAGMDQAEQQRRVERAASV 120 Query: 121 LNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELH 180 LNLT+YLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALR MR+EI ELH Sbjct: 121 LNLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRHGMRMEIGELH 180 Query: 181 QSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKMN 240 QSL TTMIYVTHDQVEAMTMADKIVVL AG IEQVGSPL LYR P NLFVAGFIGSP MN Sbjct: 181 QSLSTTMIYVTHDQVEAMTMADKIVVLRAGVIEQVGSPLDLYREPRNLFVAGFIGSPTMN 240 Query: 241 LIEGPEAAKHGATTIGIRPEHIDLSREAGA-WEGEVGVSEHLGSDTFLHVHVAGM-PTLT 298 LIEG EA KHGA TIGIRPEHI GA W G VG+SEHLGSDTFLHVH G+ ++T Sbjct: 241 LIEGDEARKHGAHTIGIRPEHIVPGDPDGAPWSGTVGLSEHLGSDTFLHVHGTGLTESIT 300 Query: 299 VRTGGEFGVHHGDRVWLTPQADKIHRFGADG 329 VR GE + HGDRV LTP A++IHRF G Sbjct: 301 VRADGEVPLRHGDRVGLTPNAERIHRFDQAG 331 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 335 Length adjustment: 28 Effective length of query: 304 Effective length of database: 307 Effective search space: 93328 Effective search space used: 93328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory