Align BadH (characterized)
to candidate WP_043920749.1 jaqu_RS19715 SDR family oxidoreductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000877395.1:WP_043920749.1 Length = 250 Score = 151 bits (382), Expect = 1e-41 Identities = 89/252 (35%), Positives = 128/252 (50%), Gaps = 10/252 (3%) Query: 4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCD 63 + A++TG GIG AT R G +A+ D + A + A +RDA A CD Sbjct: 1 MDRNLALVTGAARGIGLATTRLMLDRGWTVAMIDRDGPALDAAADGLRDA----RAFLCD 56 Query: 64 IADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHH 123 ++D V A I T G +D +VNNAG +F P +T W ++A NL G + Sbjct: 57 VSDPDQVAAMIDDVRTAFGRIDAVVNNAGVALFGPIEETGFDTWREVMATNLDGPFLVTQ 116 Query: 124 AVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVV 183 A LP + E R G +VNIAS + S+ Y K ++ +K A E GI N + Sbjct: 117 AALPALKESR-GSVVNIASISGLRASTLRVAYGTSKAAVIQLTKQQAAEFGEFGIRANCI 175 Query: 184 CPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQ 243 CPGP T L + A + +++++A+ AIPL R G ++A IAF SD+A ++TGQ Sbjct: 176 CPGPVRTKL-----AMAVHTQEIVDAYHDAIPLNRYGSEKEIASCIAFLCSDEASYVTGQ 230 Query: 244 VLSVSGGLTMNG 255 VL+ GG G Sbjct: 231 VLAADGGFEATG 242 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 250 Length adjustment: 24 Effective length of query: 231 Effective length of database: 226 Effective search space: 52206 Effective search space used: 52206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory