Align ring 1,2-phenylacetyl-CoA epoxidase PaaC subunit (EC 1.14.13.149) (characterized)
to candidate WP_043918383.1 jaqu_RS07770 phenylacetate-CoA oxygenase subunit PaaC
Query= metacyc::MONOMER-15949 (253 letters) >NCBI__GCF_000877395.1:WP_043918383.1 Length = 250 Score = 263 bits (672), Expect = 3e-75 Identities = 142/249 (57%), Positives = 167/249 (67%), Gaps = 4/249 (1%) Query: 7 LIEYLLRLGDSALIQGQRLCEWCGRAPALEEELALMNVGLDLVGQARNWLDYAAELLADG 66 L E+L R GDS LI GQRL EWCG APALEE++AL NV LDL+GQ + WL A E+ Sbjct: 4 LFEFLCRQGDSTLILGQRLGEWCGHAPALEEDIALANVALDLIGQTQMWLGLATEVEGAV 63 Query: 67 RDADHLAFRRDERAYRNLLLVEQPNGDFAVTMAKQFLYDAWHFQVLDGLSRSGDARVAGI 126 RDAD LA RRD +RNLLLVEQPNGDF T +Q+L+D +H L+ L S D RVA I Sbjct: 64 RDADDLAMRRDVWDFRNLLLVEQPNGDFGQTTMRQWLFDQFHVLQLERLCDSADDRVAAI 123 Query: 127 AAKALKEVTYHLRRSGEWVQRLGDGTEESHRRMQAAIPQLWRFTVEMSDGDEVEQRLCEA 186 AAKA+KEV YHL RS V LGDGTEESH RMQAA+ +LW + EM + D ++ L EA Sbjct: 124 AAKAVKEVRYHLERSSGTVIALGDGTEESHGRMQAALDRLWPYAGEMFESDAIDAELAEA 183 Query: 187 GIAPDPAQIAGAWQAKVAEVFAAATLPLPEPAVNFYLSGRRG--LHSEHLGLLLAEMQFL 244 GIAP+PA + W V A ATL PE +F +G R HSEHLG LLA+MQ+L Sbjct: 184 GIAPEPADLRAPWDVAVDATLAEATLTRPES--DFTQTGGRSGKRHSEHLGHLLAQMQWL 241 Query: 245 QRAYPDATW 253 RAYPDA W Sbjct: 242 PRAYPDARW 250 Lambda K H 0.321 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 250 Length adjustment: 24 Effective length of query: 229 Effective length of database: 226 Effective search space: 51754 Effective search space used: 51754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory