Align medium-chain acyl-CoA ligase (EC 6.2.1.2); phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_043917615.1 jaqu_RS03905 malonyl-CoA synthase
Query= BRENDA::O74725 (578 letters) >NCBI__GCF_000877395.1:WP_043917615.1 Length = 504 Score = 135 bits (341), Expect = 3e-36 Identities = 148/536 (27%), Positives = 228/536 (42%), Gaps = 54/536 (10%) Query: 34 RHASSRDPYTCGITGKSYSSKEVANRVDSLARSLSKEFGWAPNEGSEWDKTLAVFALNTI 93 RHA S P+ G + S A +L+ G AP + LA + Sbjct: 12 RHAGSDAPFLHLSDGDALSYGAFLGMAARFAHALTAA-GLAPGD------RLAAQIEKSP 64 Query: 94 DSLPLFWAVHRLGGVLTPANASYSAAELTHQLLDSKAKALVTCVPLLSISLEAAAKAGLP 153 D+L L+ A + G + P N +Y++ ELT+ + +S A+ LV C + A A Sbjct: 65 DALALYAACVQAGMIFLPLNTAYTSDELTYFIENSGAR-LVVCDSAKRDEVGAIADR--- 120 Query: 154 KNRIYLLDVPEQLLGGVKPPAGYKSVSELTQAGKSLPP-VDELRWSAGEGARRTAFVCYS 212 LG L A P D + S + A AF+ Y+ Sbjct: 121 -------------LGAATLTLDADGTGTLADAAADQPASFDTVPRSEDDLA---AFL-YT 163 Query: 213 SGTSGLPKGVMISHRNVIANTLQIKAFEQNYRDGGGTKPASTEVALGLLPQSHIYALVVI 272 SGT+G KG M++H N+++N + + D +V L LP H + L V Sbjct: 164 SGTTGRSKGAMLTHANLLSNAQALADIWRFTAD---------DVLLHALPIFHTHGLFVA 214 Query: 273 GHAGAYRGDQTIVLPKFELKSYLNAIQQYKISALFLVPPIIIHMLGTQDVCSKYDLSSVT 332 + G I LPKF+L + ++ + Q +A+ VP +L D DL++ Sbjct: 215 TNVTLVAGGSMIFLPKFDLDAIIDRLPQ--ATAMMGVPTFYTRLLA--DARFTGDLAAHM 270 Query: 333 SLF-TGAAPLGMETAADFLKLYPNILIRQGYGLTETCTVVSSTHPHDIWLGSSGALLPGV 391 LF +G+APL ET A F + I + YG+TET S+ + + G+ G LP V Sbjct: 271 RLFVSGSAPLLSETHAAF-EARTGHRILERYGMTETNMNTSNPYDGERRAGTVGFPLPEV 329 Query: 392 EARIVTPENKEITTYDSPGELVVRSPSVVLGYLN-NEKATAETFVDGWMRTGDEAVIRRS 450 E +I P + E G++ VR P+V GY EK AE DG+ TGD I Sbjct: 330 ELKITDPASGETLRQGEIGQIEVRGPNVFKGYWQMPEKTAAELRKDGFFITGDLGRIDED 389 Query: 451 PKGIEHVFIVDRIKELIKVKGLQVAPAELEAHILAHPDVSDCAVIAIPDDRAGEVPKAIV 510 +V IV R K+LI G + P E+E + P V + AV+ +P GE ++ Sbjct: 390 ----GYVHIVGRNKDLIISGGYNIYPKEIEVLLDEQPGVLESAVVGVPHADFGETVLGLL 445 Query: 511 VKSASAGSDESVSQALVKYVEDHKARHKWLKGGIRFVDAIPKSPSGKILRRLIRDQ 566 V E + + K + K K L +D +P++ GK+ + +R++ Sbjct: 446 VPEGDGPDLERIGAEIEKSLAGFKRPRKLL-----VIDELPRNTMGKVQKAALRER 496 Lambda K H 0.316 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 654 Number of extensions: 39 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 504 Length adjustment: 35 Effective length of query: 543 Effective length of database: 469 Effective search space: 254667 Effective search space used: 254667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory