Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_043918394.1 jaqu_RS07830 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000877395.1:WP_043918394.1 Length = 251 Score = 165 bits (418), Expect = 7e-46 Identities = 101/252 (40%), Positives = 147/252 (58%), Gaps = 14/252 (5%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 VL V G++KRFG ++A SDV + + G+++ LIGPNGAGK+T I G PDAG+ Sbjct: 5 VLSVTGLTKRFGAIEACSDVSLDLHAGEIHALIGPNGAGKSTLIAQIAGGLRPDAGSIRF 64 Query: 69 AGKPYEPTAVHEVAKA--GIARTFQNIRLFAEMTALENVMVGRH--IRTGSGLFGAVFRT 124 G+ + TA+ VA+A G+ R+FQ + + + +ENVM+ H RT FG F Sbjct: 65 LGR--DVTALDTVARARLGLGRSFQVSAVVPDYSVVENVMLALHGRDRTAFRPFGHAFGK 122 Query: 125 KGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEP 184 + E A A R L D + + AR+L++G++RRLE+A ALA P+ LDEP Sbjct: 123 RALTEEARAHAART-HLSDRLNV------PARSLAHGERRRLELAMALALRPRAFLLDEP 175 Query: 185 AAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 AG+ +L L+ +R D ILL+EHD+ V L DR++VL YG+ +A G P E+ Sbjct: 176 MAGLGQEGAAELTALLSDLR-DEAPILLVEHDMDAVFALADRISVLVYGRILATGTPDEI 234 Query: 245 QKNEKVIEAYLG 256 + + +V AYLG Sbjct: 235 RADPQVRAAYLG 246 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 251 Length adjustment: 24 Effective length of query: 236 Effective length of database: 227 Effective search space: 53572 Effective search space used: 53572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory