Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_043918392.1 jaqu_RS07820 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_000877395.1:WP_043918392.1 Length = 302 Score = 141 bits (356), Expect = 2e-38 Identities = 93/307 (30%), Positives = 162/307 (52%), Gaps = 18/307 (5%) Query: 3 IFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAP 62 + I+Q++NGL LG M L+A G T+V+GV+ LIN AHG + MVGA + V Q Sbjct: 4 LLIEQLLNGLQLGVMLFLMAAGLTLVFGVMGLINLAHGSLYMVGA---FAAAWVAAQTG- 59 Query: 63 GLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMI 122 ++A+V ++ +LIE + R L L ++ + ++ + Sbjct: 60 ------SYLLALVASLAAAAAAGVLIETLILRRLYARDHLDQVLATFALILIFSEGTRAV 113 Query: 123 WGRSPLPFPQVMP-SDPVHIAGALISPT-QIMLLALAVLAMVGLVLIVEKTKMGRAMRAT 180 +G PL P S PV + G + P +++L+ + +GL L++ +T++G ++A Sbjct: 114 FGSFPLYLTIPPPLSGPVTLPGGIEYPLFRLVLIGAGLAVALGLWLLITRTRVGIRIQAG 173 Query: 181 AENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAV 240 A + + +GVD +++ + FA+GA LA ++G + + + MG + AF V Sbjct: 174 AADREMVSALGVDISRLYTLVFALGAALAGLSGAL-VGTLQSVEVGMGEPVLITAFVVIV 232 Query: 241 LGGIGNIYGAMLGGILLGLIESLGAGYI----GDLTG-NFLGSNYQDIFAFIVLIIVLTL 295 +GGIG++ GA++G IL+GL ++LGA + LTG G + +I++ +VL + Sbjct: 233 IGGIGSVQGALVGAILVGLTQTLGAFLLPLASTRLTGAPDAGQVLASMLIYILMALVLIV 292 Query: 296 RPSGIMG 302 RP G+MG Sbjct: 293 RPQGLMG 299 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 302 Length adjustment: 27 Effective length of query: 282 Effective length of database: 275 Effective search space: 77550 Effective search space used: 77550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory