Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_043918417.1 jaqu_RS07620 sugar ABC transporter permease
Query= uniprot:D8IUD2 (328 letters) >NCBI__GCF_000877395.1:WP_043918417.1 Length = 443 Score = 115 bits (288), Expect = 2e-30 Identities = 96/291 (32%), Positives = 147/291 (50%), Gaps = 37/291 (12%) Query: 46 SAATFITLSNDIPPLVVMSVGMTFILIIGGIDLSVGSVMALAASMLSMAMVRWG-WPL-- 102 + A ++T I PL TF+ + GGI ++G + ++++A+ W W Sbjct: 171 NVAWYLTNGQTIGPL-----DPTFMQL-GGIRGTLGETWSWIVGLIAVALAVWTLWSARR 224 Query: 103 ------YAAAPL---GVVVAALCGTLTGMVSVH--WRIPSFIVSLGVLEIARGLAYQVTN 151 + PL GVV A + + G V+V + IP +++ ARGL Sbjct: 225 DKVEHDFPVKPLWAEGVVAAIVAVLILGFVAVMNAYEIPERVLAREFR--ARGL------ 276 Query: 152 SRTEYIGSAVDVISSPILFGMSPAFLSAIAIVIIAQLVLTRTVLGRYWIGIGTNEEAVRL 211 E + V S +L L AI + +IA+ RT GRY G N +A L Sbjct: 277 EMPEGLSMGYGVPYSVLL-----VVLVAIGMTVIAR----RTRFGRYIYATGGNPDAAEL 327 Query: 212 SGVNPNPSKILAFALMGALAGIAALFQVSRLEAADPNGGVGMELQVIAAVVIGGTSLMGG 271 SG++ + FAL+GAL I+A+ +RL + G EL+VIAA VIGGT+L GG Sbjct: 328 SGIDIRMLTVKVFALLGALCAISAVVASARLANHSNDIGTLDELRVIAAAVIGGTALKGG 387 Query: 272 RGSIVSTFIGVLIISVLEAGLAQVGVSEPMKRIITGAVIVVAVILDTYRRR 322 G+I +G LI+ L++G+A VGV P++ I+ GAV+V+AV++D + RR Sbjct: 388 VGTIYGALLGALIMQSLQSGMAMVGVDAPLQNIVVGAVLVLAVLIDIWYRR 438 Score = 81.6 bits (200), Expect = 3e-20 Identities = 48/142 (33%), Positives = 80/142 (56%), Gaps = 11/142 (7%) Query: 24 LGLMAALLAMCVMFAFLSEN-FLSAATFITLSNDIPPLVVMSVGMTFILIIGGIDLSVGS 82 LG++ A + +C+ F F S+ F++ L+ + +M+ GM FI+++ IDLSVGS Sbjct: 40 LGMIGAFVVICLAFHFASDGRFITPRNLFNLTIQTASVAIMATGMVFIIVMRHIDLSVGS 99 Query: 83 VMALAASMLSMAMVRW--------GWPLYA--AAPLGVVVAALCGTLTGMVSVHWRIPSF 132 V+A +++++M W G PL A A G++ A G L G + + IP+F Sbjct: 100 VLATCSAVMAMTQTAWLPALGLELGNPLLAPLAIVTGILAGAAIGALHGWLVGYLAIPAF 159 Query: 133 IVSLGVLEIARGLAYQVTNSRT 154 IV+LG L + R +A+ +TN +T Sbjct: 160 IVTLGGLLVWRNVAWYLTNGQT 181 Lambda K H 0.325 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 443 Length adjustment: 30 Effective length of query: 298 Effective length of database: 413 Effective search space: 123074 Effective search space used: 123074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory