Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_043917830.1 jaqu_RS04940 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >NCBI__GCF_000877395.1:WP_043917830.1 Length = 336 Score = 171 bits (433), Expect = 2e-47 Identities = 113/317 (35%), Positives = 178/317 (56%), Gaps = 47/317 (14%) Query: 12 AVGSIIALGAVGLTLTYGILRLSNFAHGDFM---TLAAYL-TWWANTSGINLW------L 61 A G+ +ALGA+G+TL YGILR SNFAHGD M T+A L TW + G+ L Sbjct: 20 AYGAQLALGALGVTLIYGILRFSNFAHGDTMAFGTMAVILATWGLQSLGVGFGVLPTALL 79 Query: 62 SMALGCVGTIIAMFIG-EWLLWKPMRARRATATTLIIISIGLALFLRNGIL-LIWGGNNQ 119 ++ +G + A+ +G + L+++ R RRA +I S+G+ +F+ NG+ + G ++Q Sbjct: 80 ALPVG-IAVAAALTLGTDRLVYRFYRGRRAAPVIFVIASLGV-MFVYNGLTRFVIGTDDQ 137 Query: 120 NYRVP---IVPAQDFM-------GIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRA 169 + I+ A++F G+ +++ I +A+ + L L RT+ GK+MRA Sbjct: 138 RFEDGERFIITAREFREMTGLAEGLALRTTQVITIVVAVIVVTALFWFLNRTRTGKSMRA 197 Query: 170 VADNVDLAKVSGINVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVI 229 +DN DLA +SGI+ E VV+ TW++ A L + G++YGL + KP + L+LP+FA+ I Sbjct: 198 YSDNEDLALLSGIDPERVVVITWLIVAALATVAGTLYGLDKSFKPFTYFQLLLPIFAAAI 257 Query: 230 LGGIGNPYGAIAGGIIIGVAQEVSVPW----------------------FGTSYKMGVAL 267 +GG+G+P GAIAGG +I A EV++ + T YK V+ Sbjct: 258 VGGLGSPLGAIAGGFVIAFA-EVTITYPLKRVLGYLMPESLEPDGLVQLLSTDYKFAVSF 316 Query: 268 LLMIIILFIRPQGLFKG 284 +++I+L RP GLF G Sbjct: 317 AILLIVLLFRPTGLFAG 333 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 336 Length adjustment: 27 Effective length of query: 259 Effective length of database: 309 Effective search space: 80031 Effective search space used: 80031 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory