Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_043916916.1 jaqu_RS00215 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >NCBI__GCF_000877395.1:WP_043916916.1 Length = 372 Score = 348 bits (892), Expect = e-100 Identities = 203/375 (54%), Positives = 248/375 (66%), Gaps = 17/375 (4%) Query: 1 MASVTLRNIRKAYD-ENEVMRDINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGD 59 MA++ L+++ K Y + EV++DI+LDI GE +VFVGPSGCGKSTL+RMIAGLE ISGG Sbjct: 1 MANLKLKDVAKVYGGQVEVLKDIDLDIETGELIVFVGPSGCGKSTLLRMIAGLEQISGGT 60 Query: 60 LTIDGMRVNDVAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRNAAK 119 L IDGM VNDV P++RGIAMVFQSYALYPHMT+YDNMAF L++A K EID AVR AA Sbjct: 61 LEIDGMVVNDVPPSERGIAMVFQSYALYPHMTVYDNMAFALQIAKKSKEEIDRAVRAAAD 120 Query: 120 ILHIDHLLDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMRLEFARL 179 L + LDR PK LSGGQRQRVAIGR+I R PKV+LFDEPLSNLDAALRV R+E A+L Sbjct: 121 KLQLTEYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRIEIAQL 180 Query: 180 HDEL-KTTMIYVTHDQVEAMTLADKIVVLSA-------GNLEQVGSPTMLYHAPANRFVA 231 +++ +TMIYVTHDQVEAMTLA +IVVL A ++ QVG+P LY P + FVA Sbjct: 181 KEQMPDSTMIYVTHDQVEAMTLASRIVVLDALKDNGYKYSIAQVGTPLELYETPNSEFVA 240 Query: 232 GFIGSPKMNFMEGVVQSVTHDGVTVRYETGE---TQRVAVEPAAVKQGDKVTVGIRPEHL 288 FIGSP MN +EG + + T + T+R G T V P QG +V VGIRPE Sbjct: 241 RFIGSPAMNLLEGEIVA-TGETTTLRTRLGAGTITSNVPSRPE--DQGAQVKVGIRPEDA 297 Query: 289 HVGMAED-GISARTMAVESLGDAAYLYAESSVAP-DGLIARIPPLERHTKGETQKLGATP 346 +ED S + E LG+ LY E D +IA++P + +G T KL A P Sbjct: 298 VATDSEDFAFSGKVEVEERLGEVTLLYFERGAGQNDPVIAKLPGIHPGMRGNTVKLTADP 357 Query: 347 EHCHLFDSAGKAFQR 361 H+F R Sbjct: 358 AKVHIFQDGTSLLYR 372 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 372 Length adjustment: 30 Effective length of query: 339 Effective length of database: 342 Effective search space: 115938 Effective search space used: 115938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory