Align glucose transporter, periplasmic substrate-binding component (characterized)
to candidate WP_084629538.1 jaqu_RS07615 D-xylose ABC transporter substrate-binding protein
Query= reanno::Phaeo:GFF3639 (341 letters) >NCBI__GCF_000877395.1:WP_084629538.1 Length = 343 Score = 554 bits (1428), Expect = e-162 Identities = 281/341 (82%), Positives = 301/341 (88%), Gaps = 1/341 (0%) Query: 2 KFLSGVSALAFA-ATASMAFAEDVTVGVSWSNFQEERWKTDEAAIKAALEAKGATYVSAD 60 KFL+ A + A+ A A VGVSWSNFQEERWKTDEAAI+ ALEA GATY+SAD Sbjct: 3 KFLTAAVAASMTYGGAAFADAHAPVVGVSWSNFQEERWKTDEAAIREALEAAGATYISAD 62 Query: 61 AQSSSAKQLSDIESLIAQGVDALIVLAQDAQAIGPAVQAAADEGIPVVAYDRLIEDGRAF 120 AQSSS+KQLSD+ESLIAQG DALI+LAQDAQAIGPAV+AAA+EGIPVV YDRLIED RAF Sbjct: 63 AQSSSSKQLSDVESLIAQGADALIILAQDAQAIGPAVEAAANEGIPVVGYDRLIEDPRAF 122 Query: 121 YLTFDNVEVGRMQARAVLEAQPSGNYVMIKGSPTDPNADFLRGGQQEIIQAAIDSGDIKI 180 YLTFDNVEVGRMQARAVLEAQP GNYVMIKGSPTDPNADFLRGGQQE++Q AIDSG I I Sbjct: 123 YLTFDNVEVGRMQARAVLEAQPEGNYVMIKGSPTDPNADFLRGGQQEVLQEAIDSGAITI 182 Query: 181 VGEAYTDGWLPANAQRNMEQILTANDNKVDAVVASNDGTAGGVVAALTAQGMEGIAVSGQ 240 VGEAYTDGWLPANAQRNMEQILTA DN VDAVVASNDGTAGG VAALTAQGMEGI VSGQ Sbjct: 183 VGEAYTDGWLPANAQRNMEQILTAEDNNVDAVVASNDGTAGGAVAALTAQGMEGIPVSGQ 242 Query: 241 DGDHAALNRVAKGTQTVSVWKDARDLGKAAANIAVEMAEGAVMGDVAGGAAWTSPAGTEL 300 DGDHAALNR+AKGTQTVSVWKDARDLG+AAA IAV +A G MGDV G +WTSPAGTE+ Sbjct: 243 DGDHAALNRIAKGTQTVSVWKDARDLGRAAAEIAVALAGGTEMGDVEGAQSWTSPAGTEM 302 Query: 301 TARFLEPIPVTADNLSVVVDAGWITKEALCQGVTNGPAPCN 341 TA FLEP+P+TADNLS VVDAGWI +EALCQGV NGPAPCN Sbjct: 303 TAIFLEPVPITADNLSTVVDAGWIDQEALCQGVENGPAPCN 343 Lambda K H 0.313 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 343 Length adjustment: 29 Effective length of query: 312 Effective length of database: 314 Effective search space: 97968 Effective search space used: 97968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory