Align ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate WP_043919312.1 jaqu_RS12415 ABC transporter ATP-binding protein
Query= TCDB::Q9R9Q4 (342 letters) >NCBI__GCF_000877395.1:WP_043919312.1 Length = 335 Score = 369 bits (948), Expect = e-107 Identities = 193/333 (57%), Positives = 248/333 (74%), Gaps = 5/333 (1%) Query: 1 MAELQLRDIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGTL 60 M ++L I KSFG +VI + + I+ GEF VFVGPSGCGKSTLLRLIAGLE+++SG + Sbjct: 1 MGHIKLNQITKSFGDVEVIPPLDLTIENGEFAVFVGPSGCGKSTLLRLIAGLEDVSSGHI 60 Query: 61 AFDGQIVNQLTPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAGKDKQQCRKRVEAAAEM 120 DG+ V + P++RG+AMVFQSYALYPHM+V +N+AF + +AG D+ + ++RVE AA + Sbjct: 61 EIDGRDVTDVPPAKRGLAMVFQSYALYPHMSVRKNIAFPLHMAGMDQAEQQRRVERAASV 120 Query: 121 LQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEIAKLH 180 L LT YL+R P QLSGGQRQRVAIGRAIVR+P FLFDEPLSNLDAALR R+EI +LH Sbjct: 121 LNLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRHGMRMEIGELH 180 Query: 181 RSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLELYETPNSVFVAGFIGSPKM 240 +S+ TTMIYVTHDQVEAMT+AD+I VLR G++EQ+G+PL+LY P ++FVAGFIGSP M Sbjct: 181 QSL-STTMIYVTHDQVEAMTMADKIVVLRAGVIEQVGSPLDLYREPRNLFVAGFIGSPTM 239 Query: 241 NFLSGAFAEPYKADTIGIRAEHL-EIDEQGGEWSGTVIHSEMLGSDSYIYLDIGTG--EP 297 N + G A + A TIGIR EH+ D G WSGTV SE LGSD+++++ GTG E Sbjct: 240 NLIEGDEARKHGAHTIGIRPEHIVPGDPDGAPWSGTVGLSEHLGSDTFLHVH-GTGLTES 298 Query: 298 VIVRESGIAKHQPGQTIRISPAAGQVHRFDAGG 330 + VR G + G + ++P A ++HRFD G Sbjct: 299 ITVRADGEVPLRHGDRVGLTPNAERIHRFDQAG 331 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 335 Length adjustment: 28 Effective length of query: 314 Effective length of database: 307 Effective search space: 96398 Effective search space used: 96398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory