Align ABC transporter permease (characterized, see rationale)
to candidate WP_043920039.1 jaqu_RS16210 sugar ABC transporter permease
Query= uniprot:A0A165KPZ4 (293 letters) >NCBI__GCF_000877395.1:WP_043920039.1 Length = 362 Score = 95.5 bits (236), Expect = 2e-24 Identities = 64/195 (32%), Positives = 101/195 (51%), Gaps = 8/195 (4%) Query: 84 LIGVVLAVLLDQKIRAEGALRTIYLYPMALSFV-VTGTAWKWLLNPGLG-IEKMVRD--W 139 +I LA+LL+ +IRA R +L P+ LS V V+ K + P G + ++ R W Sbjct: 154 VIAFGLALLLNAQIRARKFFRVAFLLPLMLSPVAVSWMIGKSMFEPRFGPMARLARTLGW 213 Query: 140 GFPNFEFGWLVDTEMAIYCVVIAGIWQSAGFAMALFLAGLRGIDDSIIKAAQVDGASLPR 199 P+F FG E+A + ++ W F M + LAGL+ I + +AA VDGAS R Sbjct: 214 DTPSF-FG---SPEIARFMIMAMDAWTYIPFMMIMLLAGLQAIPKELNEAASVDGASGWR 269 Query: 200 IYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAGGPGFATDVPATFMYTMSFSRGQ 259 +W + P + PV + +++ +K D+V+ +TAGGPG ATD +F++ R Sbjct: 270 KFWEVTFPLMLPVSITAILIRIIFKLKLADIVINVTAGGPGGATDTVTSFIFREYRDRSN 329 Query: 260 IGLGAASATMMLATV 274 +G G A + L + Sbjct: 330 VGYGTMLAFIYLVLI 344 Lambda K H 0.327 0.141 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 362 Length adjustment: 28 Effective length of query: 265 Effective length of database: 334 Effective search space: 88510 Effective search space used: 88510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory