Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_043920871.1 jaqu_RS20220 ABC transporter ATP-binding protein
Query= uniprot:P40735 (281 letters) >NCBI__GCF_000877395.1:WP_043920871.1 Length = 263 Score = 129 bits (325), Expect = 5e-35 Identities = 80/216 (37%), Positives = 122/216 (56%), Gaps = 10/216 (4%) Query: 6 LISVEDIVFRYRKDA-ERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESG 64 LI ++ + YR A LDG+ L V EGE+ A+VG +G GKSTL R + GL+ P++G Sbjct: 4 LIEIKGVRHAYRTPAGPLPVLDGLELSVPEGEFCAVVGPSGCGKSTLTRLVAGLMKPDAG 63 Query: 65 DIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNG--VPREEMIER 122 ++ ++G E V RK +GM FQNP T+ D+V LE +PR + + R Sbjct: 64 EVWLSG-----ERVTSPRKTVGMAFQNPV-LLEWRTILDNVILPLEIVAPRMPRRDRVAR 117 Query: 123 VDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVL 182 + + V + F D+ P LSGG +QR ++ I +P ++ILDE LD RE++ Sbjct: 118 AEELLAMVGLDGFEDKRPSELSGGMRQRASLCRSIVHKPSVLILDEPFGALDNFTREDLW 177 Query: 183 ETVRHLKEQGMATVISITHDLNEAA-KADRIIVMNG 217 +T+R L+ T I ITHDL E+ D+++V++G Sbjct: 178 QTMRDLRAAEPFTTILITHDLRESVFLGDQVVVLSG 213 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 263 Length adjustment: 25 Effective length of query: 256 Effective length of database: 238 Effective search space: 60928 Effective search space used: 60928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory