Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_043919730.1 jaqu_RS14580 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000877395.1:WP_043919730.1 Length = 269 Score = 175 bits (444), Expect = 8e-49 Identities = 91/239 (38%), Positives = 143/239 (59%) Query: 21 FGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIFDGEPIQQLQP 80 FGG++A+++ ++ +G I +IGPNGAGK+++ N++S F P +G V F G P Q++P Sbjct: 27 FGGVEAIKDISFDIREGEIRAIIGPNGAGKSSMLNVISGFYVPQEGEVWFRGAPRPQMKP 86 Query: 81 HQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQPQVVVKEEKQLQEQA 140 +Q+A+QG+ RTFQ +SVL+N++ N +Q KEE+ +E Sbjct: 87 YQVARQGIARTFQNIALFEGMSVLDNVMTGRLNAMKANIFQQAFWWGKASKEEEANRESV 146 Query: 141 MFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEPAAGVNPRLIDDICD 200 +++ + + G L G +K +E+ RAL P L+LLDEP AG+N +D+ Sbjct: 147 ERVIDFLEIQHIRKTPVGRLPYGLKKRVELARALAAEPSLLLLDEPMAGMNVEEKEDMSR 206 Query: 201 RILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPAEIQTNSQVLEAYLG 259 IL N + G T +IEH+M V+M L DRV V+ G+ + DGTPAE+++N V++AYLG Sbjct: 207 FILDVNDEFGTTIALIEHDMGVVMDLSDRVVVMDYGRKIGDGTPAEVRSNQDVIDAYLG 265 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 269 Length adjustment: 25 Effective length of query: 235 Effective length of database: 244 Effective search space: 57340 Effective search space used: 57340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory