Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_043920030.1 jaqu_RS16150 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000877395.1:WP_043920030.1 Length = 346 Score = 203 bits (517), Expect = 5e-57 Identities = 125/346 (36%), Positives = 189/346 (54%), Gaps = 21/346 (6%) Query: 14 KKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEAVSS 73 +K V+ + + I ID G ++GPSG GK+T LR++AGLE T G + + V+ Sbjct: 10 RKSYGSVQVIHGLDIDIDDGEFVVLVGPSGCGKSTLLRMVAGLEGITGGTVSIGDGVVNH 69 Query: 74 PRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLS 133 ++P KR IAMVFQN+ALYP+ TV N+AF L++A++ K +I +V +E LGL Sbjct: 70 -----LAPAKRDIAMVFQNYALYPHKTVRANMAFALRMARMDKAEIARRVDRAAEILGLG 124 Query: 134 GVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERK 193 L+RYP+ LSGGQ QR A+ RA+V++P V L DEP SNLDA++R RA +R++ + Sbjct: 125 DYLDRYPRALSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRAEIRELHQRLA 184 Query: 194 LTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTGE--INLIQA 251 TT+ V+HD + +A+K V+ +G+ Q+G P ++Y+ PA +A G +NL+ A Sbjct: 185 TTTIYVTHDQIEAMTMADKIVVLQSGRIEQMGAPLDLYDRPANIFVAGFIGSPAMNLLPA 244 Query: 252 KIIENNAIIANLKVPLNNMELKGQSN-IVIGLRPDDLTLSDTLLDKYIDMGIVKVKLVSY 310 + + L V ++L S IG+RP+ L LS+T GI V Sbjct: 245 EHRD-----GALHVSGTTLDLAAPSGPSTIGIRPEHLALSET--------GIPADVSVIE 291 Query: 311 GAGIFKIVVSPITDENIDIIVDAEEPLETGIETHLLAKPNKVKIFD 356 G +V+ + I ++ L G HL P + FD Sbjct: 292 PTGSETHIVARAQGQEIVVVTSERPALRPGDRIHLRPDPTRTHFFD 337 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 346 Length adjustment: 29 Effective length of query: 342 Effective length of database: 317 Effective search space: 108414 Effective search space used: 108414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory