GapMind for catabolism of small carbon sources

 

Alignments for a candidate for dctQ in Photobacterium gaetbulicola Gung47

Align TRAP transporter, subunit DctQ (characterized, see rationale)
to candidate WP_082060468.1 H744_RS03800 TRAP transporter small permease

Query= uniprot:I7EY26
         (225 letters)



>NCBI__GCF_000940995.1:WP_082060468.1
          Length = 153

 Score = 68.2 bits (165), Expect = 8e-17
 Identities = 36/115 (31%), Positives = 59/115 (51%)

Query: 11  LINTLEETLIALLLGLMTLITFANVVARFVFNSNILWALELTVFLFAWLVLLGASYAVKV 70
           LI  +EE L ++ + +  L+   NVV R+ F   + W+ EL+V  F W V LG S   K 
Sbjct: 3   LIRNIEEILASMAISITVLVVIVNVVLRYGFGFVVPWSEELSVVCFIWAVYLGISSCYKH 62

Query: 71  HAHLGVDAILNMVSPGARRVIGLISVGCCLVFSLLLLKGAYDYWAVFADLPPTSG 125
             H+GVD ++ ++ P A+R   L+     L  ++L+   +Y Y  +   + P  G
Sbjct: 63  KLHMGVDVVVALLPPKAKRPFKLLVSLFLLALNILMAVLSYQYTMLSNKVTPVMG 117


Lambda     K      H
   0.327    0.142    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 58
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 225
Length of database: 153
Length adjustment: 19
Effective length of query: 206
Effective length of database: 134
Effective search space:    27604
Effective search space used:    27604
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory