Align neutral amino acid transporter B(0) (characterized)
to candidate WP_044623820.1 H744_RS22180 dicarboxylate/amino acid:cation symporter
Query= CharProtDB::CH_091706 (553 letters) >NCBI__GCF_000940995.1:WP_044623820.1 Length = 435 Score = 203 bits (517), Expect = 1e-56 Identities = 139/441 (31%), Positives = 231/441 (52%), Gaps = 60/441 (13%) Query: 88 FAFPGELLLRLLKMIILPLVVCSLIGGAASL-DPSALGRVGAWALLFFLVTTLLASALGV 146 F G + + LKM+++PLV SL+ G ++L D S LGR+G L F+L TT +A +L + Sbjct: 47 FEVGGAIFIASLKMLVVPLVFVSLVCGTSTLKDISTLGRLGGKTLAFYLTTTAIAISLAL 106 Query: 147 GLALALKPGAA--VTAITSINDSVVDPCARSAPTKEALDSFLDLVRNIFPSNLVSAAFRS 204 + KPGA ++A T+ +R AP S ++ ++FP+N +S+ Sbjct: 107 VMGNLFKPGAGADLSAATTF-------ASREAP------SLGQVIIDMFPTNPISSMANG 153 Query: 205 FATSYEPKDNSCKIPQSCIQREINSTMVQLLCEVEGMNILGLVVFAIVFGVALRKLGPEG 264 N L ++VFAI+FG+A+ G G Sbjct: 154 -------------------------------------NTLQIIVFAILFGIAISAAGKPG 176 Query: 265 ELLIRFFNSFNDATMVLVSWIMWYAPVGILFLVASKIVEMKDVRQLFISLGKYIL--CCL 322 E + F N+ M LV+ +M AP G+ FL+A K+ + +F G +++ C L Sbjct: 177 ERIAGIFADLNEVIMKLVALLMNIAPFGVFFLMA-KLFTGLGLDAIFNLFGYFLVLTCTL 235 Query: 323 LGHAIHGLLVLPLIYFLFTRKNPYRFLWGIMTPLATAFGTSSSSATLPLMMKCVEEKNGV 382 L +HG++V ++ +FT +P FL + + AF T+SS+AT+P+ M+ ++ GV Sbjct: 236 L---LHGIVVYGSLFKIFTGLSPKLFLKKMEDAIMFAFSTASSNATIPVTMETATKRLGV 292 Query: 383 AKHISRFILPIGATVNMDGAALFQCVAAVFIAQLNGVSLDFVKIITILVTATASSVGAAG 442 I+ F +P+GAT+NMDG A+ Q VA FIAQ + L + ++ TAT +S+G AG Sbjct: 293 KNRIASFTVPLGATINMDGTAIMQGVATAFIAQAFNIDLTMGDYLMVIATATLASIGTAG 352 Query: 443 IPAGGVLTLAIILEAVSLPVKDISLILAVDWLVDRSCTVLNVEGDAFGAGLL-QSYVDRT 501 +P G++ LA++L V LPV+ I++I+ VD L+D T +N+ GD+ ++ +S + Sbjct: 353 VPGVGLIMLAMVLNQVGLPVEGIAIIMGVDRLLDMIRTAVNITGDSCVTCIVAKSEGEMD 412 Query: 502 KMPSSEPELIQVKNEVSLNPL 522 ++P + + EV L+P+ Sbjct: 413 INRFNDPHAGEKEEEVHLHPI 433 Score = 26.2 bits (56), Expect = 0.003 Identities = 14/57 (24%), Positives = 26/57 (45%) Query: 404 LFQCVAAVFIAQLNGVSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVSL 460 LF+ A+FIA L + + V + + T+T + G G L + A+++ Sbjct: 46 LFEVGGAIFIASLKMLVVPLVFVSLVCGTSTLKDISTLGRLGGKTLAFYLTTTAIAI 102 Lambda K H 0.323 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 553 Length of database: 435 Length adjustment: 34 Effective length of query: 519 Effective length of database: 401 Effective search space: 208119 Effective search space used: 208119 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory