Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate WP_039465681.1 H744_RS01860 maltose ABC transporter permease MalG
Query= reanno::Smeli:SM_b21105 (288 letters) >NCBI__GCF_000940995.1:WP_039465681.1 Length = 296 Score = 136 bits (343), Expect = 5e-37 Identities = 97/282 (34%), Positives = 138/282 (48%), Gaps = 18/282 (6%) Query: 21 GLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAM--FSGAGQGG--- 75 GL L + P L IV SLR E IP +LD +R FS G Sbjct: 19 GLCLFLAATIFPLLMIVAISLR---EGNFAGGELIPSNPTLDHWRLALGFSVTNSDGSVT 75 Query: 76 ---VPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLTRAVPGIA 132 PV + N++ V+ +++I +A+ + YAFAR RFK KS I G M+ + P + Sbjct: 76 PPPFPVLLWLWNTVKVAGITSIIIVALSTTSAYAFARMRFKGKSTILKGMMIFQMFPAVL 135 Query: 133 LSLPLFMLYARTGI------IDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAEAAQI 186 + L+ L+ R G ++TH LI +Y+ + +W I G+F + L EAA + Sbjct: 136 ALVALYALFDRLGQYIPFLGLNTHGGLIFSYLG-GIALHVWTIKGYFETIDGSLEEAAAL 194 Query: 187 DGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLLDYTA 246 DG TPWQAF V PL+ P +A I +F+ E +AS + V++ TL VG+ Y Sbjct: 195 DGATPWQAFRLVLLPLSVPILAVVFILSFIGVVTEVPVASLLLTDVSNYTLAVGMQQYLY 254 Query: 247 EFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG 288 W A AV+ +P T+ + QK LV GLT G VKG Sbjct: 255 PQNYLWGDFAAAAVLSAIPITTVFLLAQKFLVGGLTAGGVKG 296 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 296 Length adjustment: 26 Effective length of query: 262 Effective length of database: 270 Effective search space: 70740 Effective search space used: 70740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory