Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_044623567.1 H744_RS20505 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_000940995.1:WP_044623567.1 Length = 377 Score = 328 bits (842), Expect = 1e-94 Identities = 177/362 (48%), Positives = 239/362 (66%), Gaps = 11/362 (3%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 MA ++L + VKR+G ++ +HGIDL ++D EF VGPSGCGKST LR+IAGLE+++ G I Sbjct: 1 MAGISLNRAVKRFGKVQTIHGIDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITEGDI 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 IGG +ND+ P R ++MVFQSYALYPHMTV ENMGF LK+ G E I+ RV A+ I Sbjct: 61 CIGGVNMNDVEPSERGVAMVFQSYALYPHMTVKENMGFGLKMVGEKPEVIRQRVKHASDI 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L L LL+R+P +LSGGQRQRVA+GRAIVR P+VFLFDEPLSNLDA+LR ++R +I +LH Sbjct: 121 LQLEALLKRKPKELSGGQRQRVAIGRAIVRDPEVFLFDEPLSNLDAELRVEMRIQIARLH 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 ++ TM+YVTHDQVEAMTL+D+IV++RDG +EQVG+P ++ +PA +FVAGFIGSP MN Sbjct: 181 KQLGNTMVYVTHDQVEAMTLADKIVVLRDGRVEQVGSPLQLYYQPANEFVAGFIGSPKMN 240 Query: 241 MEEAVLTDGK-----LAFASGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGD 295 A + + L G ++ + V GQ V G+RP+ ++ + D Sbjct: 241 FIPATIAKKEPQSLMLTLPDGQSVSIAAHADG-VDVGQAVKVGIRPEHIFLKP---QSRD 296 Query: 296 ADAVHEIELPVTITEPLGNETLVFTQFNGRD-WVSRMLNPRPLRPGEAVPMSFDLARAHL 354 + IE + E LGN T +F Q+ D + + P+ G V + D HL Sbjct: 297 EQTI-GIEFQSDVVERLGNSTYLFGQYADIDGFKIHLPTDEPVVTGNIVKVYMDNHNLHL 355 Query: 355 FD 356 F+ Sbjct: 356 FN 357 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 377 Length adjustment: 30 Effective length of query: 335 Effective length of database: 347 Effective search space: 116245 Effective search space used: 116245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory