Align Short-chain dehydrogenase (characterized, see rationale)
to candidate WP_044621626.1 H744_RS07580 SDR family oxidoreductase
Query= uniprot:A0A2E7P8M8 (258 letters) >NCBI__GCF_000940995.1:WP_044621626.1 Length = 252 Score = 96.7 bits (239), Expect = 4e-25 Identities = 75/246 (30%), Positives = 118/246 (47%), Gaps = 13/246 (5%) Query: 9 VVIVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQ--FWARLTGLQPRAALFQLELQD 66 V +VTG GIG +I+L A +G RS A + R QL++ D Sbjct: 11 VALVTGATRGIGRSIALAFAQKGYDLAFCYRSNQAEAVTLMADIERAGARVLSHQLDVSD 70 Query: 67 EARCGEAVAETVRRFGRLDGLVNNAG-VNDSVGLDAGRNEFVASLERNLIHYYVMAHYCV 125 EA +++GRLD LVNNAG D + + + + A L N++ + V Sbjct: 71 EAAVTTFFGRLEQQYGRLDVLVNNAGQTRDGLLVSMEKTDMEAVLATNVVGTMLFCREAV 130 Query: 126 P-HLKATRGAILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRDDGVRVNALIPA 184 L A G+I+N+SS +A+ + Y ASKGA +LTR A + G+RVNA+ P Sbjct: 131 KLMLPARSGSIVNLSSVSAVRANKGQTNYAASKGAVEALTRALAVEVGKKGIRVNAVAPG 190 Query: 185 EVMTPLYEKWIATFENP-QEKLDAITSKIPLGKRFTTSEEMADMAVFLLSGRSSHTTGQW 243 + T + + + FE +++L L ++F ++A+ +FL + + TGQ Sbjct: 191 VIKTEMTGELLDNFEKQLKQRL--------LARKFGEPSDIAEAVLFLARPENHYITGQV 242 Query: 244 VFVDGG 249 + VDGG Sbjct: 243 LTVDGG 248 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 252 Length adjustment: 24 Effective length of query: 234 Effective length of database: 228 Effective search space: 53352 Effective search space used: 53352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory