Align L-fuculose phosphate aldolase; EC 4.1.2.17; L-fuculose-1-phosphate aldolase (uncharacterized)
to candidate WP_044621286.1 H744_RS05370 aldolase
Query= curated2:A6UTG8 (180 letters) >NCBI__GCF_000940995.1:WP_044621286.1 Length = 210 Score = 104 bits (260), Expect = 9e-28 Identities = 63/178 (35%), Positives = 96/178 (53%), Gaps = 9/178 (5%) Query: 5 KEFIKICHYLYDRKYVVGSGGNVSIKKDNLIYV-TPTDSLLGFINEEDIAVVDMDGNIIK 63 ++ + + +++R Y G GN+S+K N ++ TPT S G ++ + ++VVD+DGN I Sbjct: 8 EQMVTLARSMFERGYATGGAGNLSLKLPNGHFLATPTGSSFGRLDADRLSVVDIDGNHIS 67 Query: 64 G-APTSELYMHLNIYKKRNGVNAIVHTHSLYSTALPM-----ADKEIKLLTPESRIFLKK 117 G P+ E+ HL IY+ + NAIVH HS Y TAL D IK TP + + K Sbjct: 68 GDRPSKEVAFHLAIYRNNSACNAIVHLHSTYLTALSCLQGLDTDNAIKPFTPYFVMRIGK 127 Query: 118 IGYVDYFEARSMELANEVSKKDED--VIVLKNHGIVCVGKNLMDAYLKTEVMEEISQL 173 + + Y +A E++K+ D +L NHG V G NL DA E +EE ++L Sbjct: 128 LPVIPYLRPGDPRIAEELAKRAADYRAFLLANHGPVVTGSNLTDAVDNAEELEETAKL 185 Lambda K H 0.319 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 102 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 180 Length of database: 210 Length adjustment: 20 Effective length of query: 160 Effective length of database: 190 Effective search space: 30400 Effective search space used: 30400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory