Align Fumarate:H+ symporter of 442 aas and 14 established TMSs, DctA. Responsible for the transport of dicarboxylates such as succinate, fumarate, and malate (characterized)
to candidate WP_044624198.1 H744_RS25105 dicarboxylate/amino acid:cation symporter
Query= TCDB::Q1J1H5 (442 letters) >NCBI__GCF_000940995.1:WP_044624198.1 Length = 426 Score = 190 bits (482), Expect = 9e-53 Identities = 118/407 (28%), Positives = 204/407 (50%), Gaps = 10/407 (2%) Query: 3 KIFRSLYVQVLIAIVLGILVG--FLFPSFGEGL-KPLGDGFIKLIKMLIAPIIFATVVSG 59 KIF L+ ++I + L L ++ GL + G F+ LIK+L+ P+++ ++V G Sbjct: 8 KIFAGLFAGLIIGTAIQYLFNGVTLMDTYVLGLAEGAGGMFVSLIKLLVVPLVYVSIVCG 67 Query: 60 IAHMRDTKKVGRVGGKALIYFEVVTTFALVIGLVVANILKPGHGMNVNPATLDTSAISKY 119 I ++D GR+GGK + + T A+ L + I++PG G N+ A T A+ Sbjct: 68 IVELKDITAFGRLGGKTFALYIINTIIAITAALTIGMIIQPGAGANL--AGTVTEAVQLT 125 Query: 120 TQAAGEQSVADFLLHIIPNTLVSAFTEGDLLQVLLISVLFGFALTQLGTLGQKVLAGIEA 179 T + + +++I+P+ V AF GD+LQ++ +++L G A+ L T G + + Sbjct: 126 TTETPD--IFSLIVNIVPSNPVQAFANGDMLQIIFMAILTGLAIQALDTRGGPAIKTFKM 183 Query: 180 VNSAVFVILGFVMRLAPIGAFGAMAFTIGKYGVGTLAQLAYLMVAFYATCLLFVFVVLG- 238 N + ++G VM LAP G F M TL +A + + + ++F Sbjct: 184 ANEIMMKLVGLVMSLAPFGVFALMIQLGATLDANTLMSVAGYVALVVSMLVFWIFFFYPM 243 Query: 239 LIARFAGFSILKFIRFIKEELLLVLGTSSSESALP-RLITKLEYAGANRSVVGLVVPAGY 297 ++ G F+R +E++L L T+SS + +P + T + G ++SV G VP G Sbjct: 244 MVGLTTGIKPSAFLRHTREQILFSLSTASSNATIPVTMRTLTDKIGVSKSVAGFGVPLGA 303 Query: 298 SFNLDGTSIYLTMATLFIAQATNTHLSLGQQLGILGVLLLTSKGAAGVTGSGFITLAATL 357 + N+ G SIY+ +ATLF+A A ++ + +LL S GA GV G G + + L Sbjct: 304 TMNMSGVSIYIALATLFVANAFGQPINSADIFTLGLTILLLSIGAGGVPGGGVVMVGVLL 363 Query: 358 SAVGHVPVAGLALILGIDRFMSEARALTNFVGNGVATLVIARSEKAL 404 +G +P GLA++ +DR +N VG+ ++A+SE + Sbjct: 364 HQLG-LPPEGLAIVAAVDRINDMFCTSSNVVGDTAVNTIVAKSENEI 409 Lambda K H 0.325 0.142 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 426 Length adjustment: 32 Effective length of query: 410 Effective length of database: 394 Effective search space: 161540 Effective search space used: 161540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory