GapMind for catabolism of small carbon sources

 

Alignments for a candidate for dctQ in Photobacterium gaetbulicola Gung47

Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized)
to candidate WP_044620696.1 H744_RS01510 TRAP transporter small permease

Query= SwissProt::O07837
         (227 letters)



>NCBI__GCF_000940995.1:WP_044620696.1
          Length = 165

 Score = 79.7 bits (195), Expect = 3e-20
 Identities = 39/109 (35%), Positives = 57/109 (52%)

Query: 66  INLVWAQELCIILFVWMAKFGAAYGVRTGIHVGIDVLINRLDAPKRRFFILLGLGAGALF 125
           I+L W +EL    F+W+   G ++      H+ ID +   LD  ++++  LL       F
Sbjct: 36  ISLSWTEELARYCFIWLVYIGVSFAASRKCHIKIDAIAMLLDEKEKKYLSLLADLVFFAF 95

Query: 126 TGIIATLGANFVLHMYHASSTSPDLELPMWLVYLAIPMGSSLMCFRFLQ 174
           +  I       VL +YH   TSP L LPMW+VYLA P+G +L  FR +Q
Sbjct: 96  SSFILFHSTQMVLELYHLGQTSPALGLPMWIVYLAGPVGFALTSFRLIQ 144


Lambda     K      H
   0.328    0.143    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 75
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 227
Length of database: 165
Length adjustment: 20
Effective length of query: 207
Effective length of database: 145
Effective search space:    30015
Effective search space used:    30015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory