Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized)
to candidate WP_044620696.1 H744_RS01510 TRAP transporter small permease
Query= SwissProt::O07837 (227 letters) >NCBI__GCF_000940995.1:WP_044620696.1 Length = 165 Score = 79.7 bits (195), Expect = 3e-20 Identities = 39/109 (35%), Positives = 57/109 (52%) Query: 66 INLVWAQELCIILFVWMAKFGAAYGVRTGIHVGIDVLINRLDAPKRRFFILLGLGAGALF 125 I+L W +EL F+W+ G ++ H+ ID + LD ++++ LL F Sbjct: 36 ISLSWTEELARYCFIWLVYIGVSFAASRKCHIKIDAIAMLLDEKEKKYLSLLADLVFFAF 95 Query: 126 TGIIATLGANFVLHMYHASSTSPDLELPMWLVYLAIPMGSSLMCFRFLQ 174 + I VL +YH TSP L LPMW+VYLA P+G +L FR +Q Sbjct: 96 SSFILFHSTQMVLELYHLGQTSPALGLPMWIVYLAGPVGFALTSFRLIQ 144 Lambda K H 0.328 0.143 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 75 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 227 Length of database: 165 Length adjustment: 20 Effective length of query: 207 Effective length of database: 145 Effective search space: 30015 Effective search space used: 30015 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory