Align The dicarboxylate (succinate, fumarate, malate and oxaloacetate):H+ symporter, DctA (probably 3H+ are transported per succinate taken up (characterized)
to candidate WP_107291651.1 H744_RS22530 dicarboxylate/amino acid:cation symporter
Query= TCDB::P96603 (421 letters) >NCBI__GCF_000940995.1:WP_107291651.1 Length = 435 Score = 209 bits (532), Expect = 1e-58 Identities = 121/402 (30%), Positives = 210/402 (52%), Gaps = 6/402 (1%) Query: 3 LFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIAKM 62 LF N+ VQV+ A+ +G +VG + PLG FI+ +KM++ P++ I+ G A + Sbjct: 23 LFGNIGVQVVIAMCVGTLVGAMMGQSASMFAPLGSIFIHLIKMLVIPLVAVAIISGAAGL 82 Query: 63 GDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNGGQ 122 G + GKVG +F + + +A+ + LF+ + +PG G+D + +E + Y G Sbjct: 83 GSSQSAGKVGLSTLGFFGLTSAVAVALALFMGVVFQPGVGVDMTGVEGMFSNVYADKGEM 142 Query: 123 GIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAAL-GEKGKSVIDFFDKVSHV 181 W + ++P+N+ + + +ILQ+L F + FG+ ++ L E+ +I+ + + Sbjct: 143 PTFWAT-VLGMIPTNVFQSLNEANILQILVFCLFFGIAVSKLEKERRDPLINGVNAIVDA 201 Query: 182 FFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNIICKL 241 +I +M+ AP+G FG MA +G FG ++ + L + + + ++ F+ + K Sbjct: 202 MVWMINVVMKVAPLGVFGLMADAVGTFGFSALMVVFKLFVVYVVAILIYGFIFYPAMIKA 261 Query: 242 YG-FSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKM-ERYGCSKSVVGLVIPTGYSFNL 299 + S +L +K + L T+SS + LP M+ E G S V+P G + N+ Sbjct: 262 FSKTSPLKFLSAMKKPQAVALSTASSMATLPVTMEVCEEELGVKNSTASFVLPLGATINM 321 Query: 300 DGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQ 359 G +IY + +F AQ+F V+L +G I II+ L + G AGV G F+V+A L+A Sbjct: 322 SGNAIYYGLVAIFFAQMFNVELGMGAYIAIIVTSTLGAVGQAGVPGPSFLVVAVLLAA-- 379 Query: 360 VIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENE 401 IP+EGL LL +DR R +N+ G+ +IV N+ Sbjct: 380 GIPIEGLPLLFALDRIFDMIRTALNITGDAACAVIVDNMIND 421 Lambda K H 0.326 0.143 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 435 Length adjustment: 32 Effective length of query: 389 Effective length of database: 403 Effective search space: 156767 Effective search space used: 156767 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory