Align Fe(3+) dicitrate-binding periplasmic protein; Iron(III) dicitrate-binding periplasmic protein (characterized)
to candidate WP_050183879.1 VP97_RS19685 ABC transporter substrate-binding protein
Query= SwissProt::P15028 (300 letters) >NCBI__GCF_000966195.1:WP_050183879.1 Length = 321 Score = 184 bits (466), Expect = 3e-51 Identities = 103/270 (38%), Positives = 158/270 (58%), Gaps = 4/270 (1%) Query: 23 TVQDEHGTFTLEKTPQRIVVLELSFADALAAVDVIPIGIADDNDAKRILPEVRAHLKPWQ 82 T+ E G +E TP+++V LELSF D+L A+ + GIADD + K ++ ++ + Sbjct: 49 TITHEMGETEIEGTPKKVVALELSFVDSLNALGIEAAGIADD-EKKEMIAKLVGKETDYT 107 Query: 83 SVGTRAQPSLEAIAALKPDLIIADSSRHAGVYIALQQIAPVLLLKSRNETYAENLQSAAI 142 SVGTR QP+LE I++L+PDLIIAD+ RH VY LQ+IAP ++LKSR TY ENL + Sbjct: 108 SVGTREQPNLEVISSLQPDLIIADAERHKNVYEDLQKIAPTIVLKSRESTYQENLGAFNT 167 Query: 143 IGEMVGKKREMQARLEQHKERMAQWASQLPKGTRVAF--GTSREQQFNLHTQETWTGSVL 200 I + VGK+ E + RL +H++ + + ++L V R+ F HT ++ G +L Sbjct: 168 IAQAVGKEEEAKTRLAEHEKTIEETKAKLKADPNVTILPAVVRDTSFQAHTSSSYDGELL 227 Query: 201 ASLGLNVPAAMAGASMPSIGLEQLLAVNPAWLLVAHYREESIVKRWQQDPLWQMLTAAQK 260 LG A + LEQL+ ++P LL+A+ + I W+ +PLW+ L A + Sbjct: 228 EHLGFK-NAIQQEEPYAEMNLEQLVEIDPDILLLANNDGKLITDEWKNNPLWKNLKAVKN 286 Query: 261 QQVASVDSNTWARMRGIFAAERIAADTVKI 290 QV VD + W R RG+ +AE I A+ +++ Sbjct: 287 GQVYDVDRDLWTRFRGVVSAEAIGANMLEM 316 Lambda K H 0.320 0.131 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 321 Length adjustment: 27 Effective length of query: 273 Effective length of database: 294 Effective search space: 80262 Effective search space used: 80262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory