Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_156153535.1 VP97_RS16910 iron chelate uptake ABC transporter family permease subunit
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_000966195.1:WP_156153535.1 Length = 342 Score = 186 bits (472), Expect = 7e-52 Identities = 104/280 (37%), Positives = 168/280 (60%), Gaps = 6/280 (2%) Query: 55 LVQNLRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPT 114 ++ LR+PR++ A GA LA++G ++Q +T NP+ASPS++GI +G++ +AL + + Sbjct: 63 IIHELRMPRAVAAAAAGAFLAVSGAIMQGMTRNPLASPSIMGITAGSSFVLAL-AFIFDA 121 Query: 115 PIAGYSLSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLA 174 + L F + G G+ LV G + KL LAG A++A LT ++ LA Sbjct: 122 HASPNKLVFWSFVGSGLGAFLVFGIGALSKRGLTPVKLALAGSAVTAL---LTSVSSALA 178 Query: 175 E--DHAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLG 232 D A + +W AGGV+ RW+ V +LP+ V + +L++ + +L+L + A LG Sbjct: 179 MHFDVARDLSFWYAGGVAGIRWESVRVVLPIAVVGLAAAMLISRSITVLSLGEEVAKGLG 238 Query: 233 VNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGAT 292 + ++ ++VLLL GA VS+AG V F+GL++PH+ RF G D R ++P S +LG Sbjct: 239 QKVKLAKVSGLLVVLLLTGAAVSLAGVVGFVGLVIPHITRFLVGVDYRWIIPCSAVLGGL 298 Query: 293 LMLLADVLARALAFPGDLPAGAVLALIGSPCFVWLVRRRG 332 L+++AD++AR + P + P GAV AL+G P F++L RR G Sbjct: 299 LLIMADIMARMINPPFETPLGAVTALVGVPFFLYLSRREG 338 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 342 Length adjustment: 28 Effective length of query: 304 Effective length of database: 314 Effective search space: 95456 Effective search space used: 95456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory