Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_050183865.1 VP97_RS19680 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_000966195.1:WP_050183865.1 Length = 334 Score = 213 bits (542), Expect = 5e-60 Identities = 124/312 (39%), Positives = 187/312 (59%), Gaps = 8/312 (2%) Query: 7 IFITLALAGCALLSLHMGVIPVPWRALL---TDWQAGHEHYYVLMEYRLPRLLLALFVGA 63 I I L L G +LS+ +G + + +L DW E ++ RLPR ++ + VGA Sbjct: 17 IGIILLLIG-VVLSISVGAADIKAQTVLHSFIDWDESKEQV-IIRTLRLPRAVIGVLVGA 74 Query: 64 ALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPSLPVMVLPLLAFAGGMAGL 123 +LAVAG L+Q I +N LASP + GVN ASL V +L+L P L L AF G G Sbjct: 75 SLAVAGALMQAITKNALASPQVFGVNAGASLFVVSSLVLFPGLSSASLVYAAFLGAALGG 134 Query: 124 ILLKMLAKTH--QPMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWS 181 +++ A P+KLAL G+A+ +SLT ++L Q +AL W+ G++ G+ W+ Sbjct: 135 VIVYSFASGGGMTPVKLALAGMAVHFFLSSLTQGVVLFSDQG-KDALYWMVGAINGKSWT 193 Query: 182 FVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVA 241 V++ +P + L L+ + R + +L LG++ A LG V R A LL + + VA Sbjct: 194 HVELMLPWSLGGLILAAALSRSISVLVLGESLAQGLGQKVTQIRILAGLLVIVLAGASVA 253 Query: 242 ACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPLELPVGVL 301 GP+ F+GL+VPH+++ + GG +RR++P SAL GALL+V AD+L+R I P E PVG++ Sbjct: 254 VAGPVGFVGLIVPHIVKKLVGGDYRRIIPFSALFGALLVVYADILSRFIAYPFESPVGIV 313 Query: 302 TAIIGAPWFVWL 313 TA+IGAP+F++L Sbjct: 314 TALIGAPFFLYL 325 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 334 Length adjustment: 28 Effective length of query: 290 Effective length of database: 306 Effective search space: 88740 Effective search space used: 88740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory