Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_046104583.1 VE26_RS08700 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_000969445.1:WP_046104583.1 Length = 366 Score = 177 bits (449), Expect = 4e-49 Identities = 114/306 (37%), Positives = 169/306 (55%), Gaps = 22/306 (7%) Query: 37 ADATRALLPGHTPTLPEALVQNLRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLG 96 ADAT+ L+ H A+V N+RLPR L+ +LIGA LA++G L+Q L NP+A P L+G Sbjct: 66 ADATQ-LVRDH------AVVINIRLPRMLLGMLIGAGLAVSGLLMQGLFRNPLADPGLVG 118 Query: 97 INSGAALAMALTSALSPTPIAG-------YSLSFIAACGGGVSWLL---VMTAGGGFRHT 146 ++SG+AL L T A ++L A GG + + V T GG Sbjct: 119 VSSGSALGAVSVIVLGTTMFAPLTQALGIFTLPAAAFLGGLFTTAILYRVATRGGQTAIA 178 Query: 147 HDRNKLILAGIALSAFCMGLTRITLLLAED-HAYGIFYWLAGGVSHARWQDVWQLLPVVV 205 ++LAGIAL A ++ + + +A D + +W G ++ A W ++ P++V Sbjct: 179 ----TMLLAGIALGALAGAISGVLVYVASDAQLRDLTFWGMGSLAGATWIKIFAAGPIIV 234 Query: 206 TAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGL 265 A+ LA LN L L ++TA LGV + R + V + V GA V+V+G + F+G+ Sbjct: 235 LALVTSSFLAKGLNALTLGEATAAHLGVPVQRFKRVAILAVAAATGASVAVSGGIGFVGI 294 Query: 266 LVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAFPGDLPAGAVLALIGSPCFV 325 +VPHL R G D R +LP + LLGA+ +LLAD L+R + P +LP G V A G P F+ Sbjct: 295 VVPHLLRLVIGPDHRYLLPATALLGASFLLLADALSRTIVAPAELPIGIVTAAFGGPFFL 354 Query: 326 WLVRRR 331 W++ RR Sbjct: 355 WILLRR 360 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 366 Length adjustment: 29 Effective length of query: 303 Effective length of database: 337 Effective search space: 102111 Effective search space used: 102111 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory