Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_046104916.1 VE26_RS02120 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_000969445.1:WP_046104916.1 Length = 342 Score = 190 bits (483), Expect = 4e-53 Identities = 117/294 (39%), Positives = 173/294 (58%), Gaps = 17/294 (5%) Query: 36 DWQAGHEHYYVLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLA 95 +W E+ ++ R PR+LLA VG LA GV +Q +VRNPLA P +LG++ S A Sbjct: 48 NWTGAQEN--IVWMLRFPRVLLAAVVGGGLAAVGVAMQAVVRNPLADPYVLGIS---SGA 102 Query: 96 SVGALLLMPS-----LPVMVLPLLAFAGGMAGLILLKMLAKTH---QPMKLALTGVALSA 147 SVGA+L++ + + + AFAG +A L+ ++A P++L L G+A Sbjct: 103 SVGAVLVLGTGAFGFFGIYAVSAGAFAGAVASFTLVFLIAVAGGQLSPLRLVLAGMACGY 162 Query: 148 CWASLTDYLMLSRPQD--VNNALLWLTGSLWGRDWSFVKI-AIPLMILFLPLSLSFCRDL 204 + LT ++L+ NA+ W+ GSL G WS + + + L++ L LSLS R L Sbjct: 163 SLSGLTSLIVLTSENRELARNAMEWMLGSLGGASWSDLGLPSAVLLVGTLWLSLSG-RAL 221 Query: 205 DLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGR 264 + L +GD A TLG+ V R ++ +T VA G I F+GLV+PH++R + G Sbjct: 222 NALLVGDDTARTLGIDVGRLRVTLFIVLSLLTGVMVAVSGAIGFVGLVIPHVVRMLVGTD 281 Query: 265 HRRLLPVSALTGALLLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLVRMR 318 HRR+LPVS L GA+ LV D++AR+ P+ELPVGV+TA++G P+FVW+LV R Sbjct: 282 HRRVLPVSVLIGAIFLVWVDVVARMAFAPIELPVGVITALLGGPFFVWMLVAQR 335 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 342 Length adjustment: 28 Effective length of query: 290 Effective length of database: 314 Effective search space: 91060 Effective search space used: 91060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory