Align arginine N-succinyltransferase; EC 2.3.1.109 (characterized)
to candidate WP_046157873.1 VL52_RS15520 arginine/ornithine succinyltransferase subunit alpha
Query= CharProtDB::CH_107315 (338 letters) >NCBI__GCF_000971335.1:WP_046157873.1 Length = 339 Score = 293 bits (751), Expect = 3e-84 Identities = 153/340 (45%), Positives = 219/340 (64%), Gaps = 6/340 (1%) Query: 1 MLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYF 60 M +RP + +DLP ++RLA S +GVTSLP + E+L ++I S ++F E + Y+ Sbjct: 1 MFTVRPVRTSDLPAIERLAQASGIGVTSLPSNREKLFERIQQSVSAFEHEATGEASRDYY 60 Query: 61 -FVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTG 119 F LE G +VG ++I ASAGF EPFYS+R+ET VHASR+L ++N++HVL++CHDLTG Sbjct: 61 MFALEQG--GAVVGTASICASAGFDEPFYSYRSETAVHASRALKVNNRVHVLNICHDLTG 118 Query: 120 NSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNA 179 L F+V L ++ EL SR RLLF+A ERF ++ E+ G D+ G+SPFWNA Sbjct: 119 TVQLCGFFVDSGL-DAIAGELMSRARLLFIAGERERFGRRIIAEMQGVHDDAGQSPFWNA 177 Query: 180 VGRNFFDLNYIEAEKLSGLKSRTFLAELMPHYPIYVPLLPDAAQESMGQVHPRAQITFDI 239 +GR FF+L++++ E+ S+TF+AELMP YPIYVPLLPD AQ+++GQ+HP + + Sbjct: 178 IGRRFFNLDFLQVEQAFVSHSKTFIAELMPSYPIYVPLLPDEAQQAIGQIHPHFERVCQL 237 Query: 240 LMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKI-GEAPKSGRPYLVTNGQLQ 298 L +EGFE DNY+DIFDGG L A ++++ SR PV+I P LV+N +L Sbjct: 238 LCKEGFEADNYLDIFDGGAVLTAELDRLKTVEHSRAYPVEIQASLPAQASLQLVSNQRLA 297 Query: 299 DFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAV 338 F A + G ++ +AA+ALGV G VR+ + Sbjct: 298 GFAATAARVAVVDG-VAFINPDAAKALGVSSGDRVRVAGL 336 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 339 Length adjustment: 28 Effective length of query: 310 Effective length of database: 311 Effective search space: 96410 Effective search space used: 96410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory