Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_046158297.1 VL52_RS17825 ABC transporter substrate-binding protein
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_000971335.1:WP_046158297.1 Length = 254 Score = 245 bits (626), Expect = 6e-70 Identities = 128/257 (49%), Positives = 173/257 (67%), Gaps = 4/257 (1%) Query: 1 MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE 60 MKK ++ A + SL A + L+IG++ YPPF+ + DG GFD DI N+LC Sbjct: 1 MKKALIASAGIALLASLS--AQAETLRIGVDLNYPPFSKQGADGKPQGFDIDIANSLCAA 58 Query: 61 MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAGT 120 MKV C V Q++DGLIPAL K DAI+SSM IT +R+K+VDF++KYYN +R+V K GT Sbjct: 59 MKVTCQIVPQDWDGLIPALNANKFDAIISSMQITPERQKAVDFSHKYYNIASRMVAKDGT 118 Query: 121 QVSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVA 180 +V + A LKGKKIGV R S +FA++ GA I Y E +LD+ +GR+D Sbjct: 119 KV--DAASLKGKKIGVLRASTQEKFAKDNWGKNGAAIVSYAKSPESFLDLKSGRVDAVFV 176 Query: 181 DATLLDDGFLKTDSGKGFAFVGPAFTDEKYFGDGIGIAVRKGDKAELDKINAAIVAIRAN 240 D+ + + FLKT KG+AFVGP ++D KYFG G GIAV+KG+KA ++++N AI IR + Sbjct: 177 DSAVGEQEFLKTAQAKGYAFVGPNYSDVKYFGPGCGIAVKKGNKALVERLNKAIDQIRKD 236 Query: 241 GKYKQIQDKYFNFDIYG 257 G YK++QDKYF+FDIYG Sbjct: 237 GAYKKVQDKYFSFDIYG 253 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 254 Length adjustment: 24 Effective length of query: 234 Effective length of database: 230 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory