Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_046157452.1 VL52_RS13280 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000971335.1:WP_046157452.1 Length = 361 Score = 201 bits (512), Expect = 2e-56 Identities = 119/321 (37%), Positives = 190/321 (59%), Gaps = 23/321 (7%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M + +KNV K F G A+++V++++E GE F +LGPSG GKTT +R++AG + P G Sbjct: 1 MALLEIKNVVKRF--GDYTAVNDVSLSVEAGEFFTLLGPSGCGKTTLLRMLAGFEQPDAG 58 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 ++ D + ++ V PE R + VFQ++AL+P++T ENIAFPL K K +I + Sbjct: 59 QILLDGQDMSQ-----VAPEKRPVHTVFQSYALFPHMTVRENIAFPLKMAKWDKRKIAAQ 113 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 V+E+ + + + + +P E+SGGQ+QRVA+ARALV P LLLLDEP S LDA++R+ + Sbjct: 114 VDELLEDVRLTQFGDRYPHEMSGGQRQRVAIARALVDRPRLLLLDEPLSALDAKLREEMQ 173 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASL 240 + +Q +G+T + V+HD + A++ R+ V+ GK+ Q+ PE LY P + VA Sbjct: 174 IELINLQKEVGITFVYVTHDQGEALALSHRIAVMSHGKVEQLDAPEKLYSYPKNRFVADF 233 Query: 241 IGEINELEG--KVTNEGVVIGSLR---------FPVSVSSDRAIIGIRPEDVKLSKDV-- 287 +G+ N LEG K + + +L+ P + + +RPE VKL K++ Sbjct: 234 LGQCNVLEGTVKALHGDAMTVALKGCGDVKCQAVPGVKEGQQGWLALRPEKVKLDKELPE 293 Query: 288 IKDDSWILVGKGKVKVIGYQG 308 + D+++ KG+V Y G Sbjct: 294 LPDEAYF---KGRVHDCLYLG 311 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 361 Length adjustment: 29 Effective length of query: 324 Effective length of database: 332 Effective search space: 107568 Effective search space used: 107568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory