Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_046158690.1 VL52_RS19950 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::Q9I5I4 (272 letters) >NCBI__GCF_000971335.1:WP_046158690.1 Length = 262 Score = 117 bits (294), Expect = 2e-31 Identities = 85/261 (32%), Positives = 129/261 (49%), Gaps = 14/261 (5%) Query: 19 LTVEKHGHTALITINHPPANTWDRDSLIG-LRQLIEHLNRDDDIYALVVTGQGPKFFSAG 77 L +E+ G A + +N P + + LI L + + LNR D+ +V+ G+G K F AG Sbjct: 6 LQIEQQGKVATVWLNRPDLHNALNEVLIAELTEAMRQLNRKQDVRVIVLAGRG-KSFCAG 64 Query: 78 ADLNMFADGDKARAREMARRFGEAFEALRDFRGVS------IAAINGYAMGGGLECALAC 131 ADL+ +A A +A + +GV IA I+G AM GG A C Sbjct: 65 ADLDWMR---RAAGYSEAENLADAQKLAAMLKGVYRSAKPVIARIHGAAMAGGTGLAAVC 121 Query: 132 DIRIAERQAQMALPEAAVGLLPCAGGTQALPWLVGEGWAKRMILCNERVDAETALRIGLV 191 DI IA A+ AL E +GL+P G +G A+R L ER+ A TAL++GL+ Sbjct: 122 DIAIATDAAKFALTEVRLGLVPATIGPYVAD-AIGPRQARRYFLSAERITAGTALKLGLI 180 Query: 192 EQVVDSGEARGAALLLAAKVARQSPVAIRTIKPLIQGARERAP--NTWLPEERERFVDLF 249 ++V +A ++A+ +P A+R K L+ RE +P + L R + Sbjct: 181 HELVSEELLDERVAEIAEELAKGAPGALREAKLLLAELREGSPWDDQLLEHTAGRIASIR 240 Query: 250 DAQDTREGVNAFLEKRDPKWR 270 ++ REG+ +F EKR PKW+ Sbjct: 241 AGEEAREGLASFFEKRAPKWQ 261 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 262 Length adjustment: 25 Effective length of query: 247 Effective length of database: 237 Effective search space: 58539 Effective search space used: 58539 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory