Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate WP_046158329.1 VL52_RS17815 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_05500 (242 letters) >NCBI__GCF_000971335.1:WP_046158329.1 Length = 221 Score = 108 bits (269), Expect = 1e-28 Identities = 69/212 (32%), Positives = 112/212 (52%), Gaps = 6/212 (2%) Query: 26 GTWMTIKLSALSLLLSVLLGLLGASAKLSRVKLLRIPAQLYTTLIRGVPDLVLMLLIFYS 85 G +T++L LSLLL + + + A A++S+ + L L+ + RG P LV + +I+Y Sbjct: 7 GLILTLELLGLSLLLGLAMAVPLAVARVSKNRALAGAVWLFGYVFRGTPLLVQLFIIYYG 66 Query: 86 LQT--WLTSFTDFMEWEYIEIDPFGAGVITLGFIYGAYFTETFRGAILAVPRGQVEAATA 143 L W+ D W Y++ D + ++ AY TE G I A G++EAA + Sbjct: 67 LAQFDWVR---DSWAWRYLQ-DAYVCAILAFTLNTAAYTTEIIAGQIRATHWGEIEAARS 122 Query: 144 YGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGLADLVKAAQDAGKSTYQ 203 G+ + R +V P +R ALP N ++ML++TA+ ++ LADL A+ +Y Sbjct: 123 MGMSQWLMLRRIVLPSALRRALPAYSNEVIMMLQSTAIAGLVTLADLTGVARRIYSESYM 182 Query: 204 LFYFLVLAALIYLLITSASNFILRWLERRYAA 235 F + AALIYL +T ++++ ERRY A Sbjct: 183 PFEPFLTAALIYLALTFGLVWLMKRAERRYLA 214 Lambda K H 0.329 0.142 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 221 Length adjustment: 23 Effective length of query: 219 Effective length of database: 198 Effective search space: 43362 Effective search space used: 43362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory