Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_046158690.1 VL52_RS19950 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_000971335.1:WP_046158690.1 Length = 262 Score = 108 bits (269), Expect = 1e-28 Identities = 79/256 (30%), Positives = 131/256 (51%), Gaps = 11/256 (4%) Query: 5 ERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDL- 63 E+Q V + LNRP+ NA+ L+ L A+++ ++VR ++L G G++F AG DL Sbjct: 9 EQQGKVATVWLNRPDLHNALNEVLIAELTEAMRQLNRKQDVRVIVLAGRGKSFCAGADLD 68 Query: 64 ---TEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAV 120 G + + A ++ +++ + KP++ ++G A G LA D+ +A Sbjct: 69 WMRRAAGYSEAENLADAQKLAAMLKGVYRSAKPVIARIHGAAMAGGTGLAAVCDIAIATD 128 Query: 121 GASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAE 180 A F VR+GLVP + + + +G +A+ L + R++A AL LGL+H +V E Sbjct: 129 AAKFALTEVRLGLVP-ATIGPYVADAIGPRQARRYFLSAERITAGTALKLGLIHELVSEE 187 Query: 181 KLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALE----AVLQGQAGQTQDH 236 L E +A+ELA+G A K LL E S + LE + +AG ++ Sbjct: 188 LLDERVAEIAEELAKGAPGALREAKLLLAELREGSPWDDQLLEHTAGRIASIRAG--EEA 245 Query: 237 EEGVRAFREKRPPRFQ 252 EG+ +F EKR P++Q Sbjct: 246 REGLASFFEKRAPKWQ 261 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 262 Length adjustment: 24 Effective length of query: 230 Effective length of database: 238 Effective search space: 54740 Effective search space used: 54740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory