Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_046155644.1 VL52_RS02940 3-oxoacyl-ACP reductase FabG
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000971335.1:WP_046155644.1 Length = 245 Score = 108 bits (271), Expect = 8e-29 Identities = 79/256 (30%), Positives = 123/256 (48%), Gaps = 16/256 (6%) Query: 7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGN-NCVFAPADV 65 S++G VA++TG + G+G A A+ L +GA + SG A ++L +V Sbjct: 2 SLQGKVALVTGASRGIGAAIADALAAEGAVVIGTATSESGAAAIHERLSAAGGAGRVLNV 61 Query: 66 TSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGT 125 T E V+ + + +FG V + VN AGI +K ED+ ++D NL Sbjct: 62 TEEGAVEALVESVEKEFGAVAILVNNAGITRDGLLMRMKD------EDWDAIMDTNLKSV 115 Query: 126 FNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARD 185 F + V M + + G IIN ASV G GQA Y+A+K GI+G T +AR+ Sbjct: 116 FKTSKAVMRGMMK------ARAGRIINIASVVGVMGNAGQANYAAAKAGIIGFTKSMARE 169 Query: 186 LAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIEN-- 243 + I V +APG T + SLPE L Q+ +RLGD + A V + + Sbjct: 170 VGSRNITVNCVAPGFIDTDMTRSLPEAQREALVGQIAL-NRLGDVKDIADAVVFLASDRA 228 Query: 244 PFLNGEVIRLDGAIRM 259 ++ G+ + ++G + M Sbjct: 229 SYITGQTLHVNGGMLM 244 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 245 Length adjustment: 24 Effective length of query: 237 Effective length of database: 221 Effective search space: 52377 Effective search space used: 52377 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory