Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate WP_082113695.1 VL52_RS09785 SDR family oxidoreductase
Query= SwissProt::O08756 (261 letters) >NCBI__GCF_000971335.1:WP_082113695.1 Length = 251 Score = 97.1 bits (240), Expect = 3e-25 Identities = 75/250 (30%), Positives = 122/250 (48%), Gaps = 22/250 (8%) Query: 14 VVTGGASGPWLATAKRLVGQGATAVLLDVPDSEGESQAKKLGESCI----FAPANVTSEK 69 VV+GG+ L + L+ G D+ ++ +L +S + A+VT Sbjct: 16 VVSGGSRSLGLKICESLLAGGYRVATFSRNDT---AELSRLRDSAAGDFHWEAADVTDAP 72 Query: 70 EIQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINVNLIGTFNVI 129 + L A+EK G + VN AG+ YH+ + +D R++ VNL G + Sbjct: 73 ALSRFLGRAREKLGPLRGLVNNAGV------YHEGLLAMSRPDDIARLLEVNLGGAIRLA 126 Query: 130 RLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIDGMTLPIARDLAPT 189 +L A +M G G I+N +SVA G G AAYSA+K +DG+T +AR+L P Sbjct: 127 QLCAKQM------MVGGGGAIVNVSSVAGVRGFEGVAAYSATKAALDGLTRSLARELGPM 180 Query: 190 GIRVVTIAPGLFATPLLTTLPEKVRNFLASQVPFPSRLGDPAEYAHLVQTII--ENPFLN 247 IRV +APGL T +++ + + + L Q P RL + A +V+ ++ E F+ Sbjct: 181 RIRVNAVAPGLMETEMVSGMVARQKEQLVRQTPL-GRLTTVDDAASVVRFLLSDEAGFVT 239 Query: 248 GEVIRLDGAI 257 G+ + +DG + Sbjct: 240 GQTLIVDGGL 249 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 251 Length adjustment: 24 Effective length of query: 237 Effective length of database: 227 Effective search space: 53799 Effective search space used: 53799 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory