Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_046158332.1 VL52_RS17970 enoyl-CoA hydratase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_000971335.1:WP_046158332.1 Length = 261 Score = 105 bits (263), Expect = 7e-28 Identities = 91/251 (36%), Positives = 136/251 (54%), Gaps = 11/251 (4%) Query: 5 ERQDGVLVLTL-NRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAF-SAGQD 62 ER ++TL N P N +T + L+ L A L+ D +VR++++TGAG AF SAG D Sbjct: 8 ERLGKSAIITLSNLPA--NLLTTDGLNELTATLQALNADDDVRSVVITGAGDAFFSAGAD 65 Query: 63 LTEF--GDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAV 120 L +F GD K + L+ + ++A+ V AVNG A G G+ AL D +A Sbjct: 66 LKQFAAGD-KAAADVVLQAFANALQAIRAYRGVTVAAVNGFALGGGLECALVCDYIIAER 124 Query: 121 GASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAE 180 G+ ++GL+P +G + L VG++ A+ ++L +SAE+AL +GL+ VV Sbjct: 125 GSKLGLPEAKVGLIPAAGGTKTLADKVGVSWAKRIILGGEVVSAEQALKIGLIEEVVDQG 184 Query: 181 KLMEEALSLAKELA-QGPTRAYALTKKLLLETYRLSLTEALALE-AVLQGQAGQTQDHEE 238 A+SLA ++A QGP A A +KL+ ++ L+L E L E A G G + + E Sbjct: 185 FAKIVAVSLANKVAGQGPV-AVAAARKLIEDSPNLNLDEHLKRERAATLGLVGGS-EQLE 242 Query: 239 GVRAFREKRPP 249 GV AF KR P Sbjct: 243 GVAAFLAKRAP 253 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 261 Length adjustment: 24 Effective length of query: 230 Effective length of database: 237 Effective search space: 54510 Effective search space used: 54510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory