Align D-ribose-binding periplasmic protein; EC 3.6.3.17 (characterized)
to candidate WP_046158020.1 VL52_RS16360 ABC transporter substrate-binding protein
Query= CharProtDB::CH_003593 (296 letters) >NCBI__GCF_000971335.1:WP_046158020.1 Length = 313 Score = 109 bits (273), Expect = 7e-29 Identities = 88/292 (30%), Positives = 139/292 (47%), Gaps = 8/292 (2%) Query: 9 LVSAVALSATVSANAMAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLDSQNNP 68 L S L+++V A A I + V L+NPF+ +L GA + A +L + + N Sbjct: 6 LFSLALLASSVPAAATNLSRIGISVGALDNPFYQALARGAVQAAHRLNPAVRITSQSANF 65 Query: 69 AKELANVQ--DLTVRGTKILLINPTDSDAVGNAVKMANQANIPVITLDRQATKGEVVSHI 126 E Q L + ++L+ DS AV V+ A A I V+ +D A +V + Sbjct: 66 TLEQQQEQLRRLIAQKVDLILLGAVDSRAVAPLVRQARAAGITVVAVDVDAP--DVDGTV 123 Query: 127 ASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTSAARERGEGFQQAVAAHKF--NVLAS 184 SDN G+I Y+A++ G + +QG ++ +R G A+AA V Sbjct: 124 KSDNRQAGEIVCRYLAQRLN-GRGTLVVQGGPPITSVSDRAAGCHAALAAFPRIRAVDDG 182 Query: 185 QPADFDRIKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKSDVMVVGFDGTPD 244 A + G MQ L PD+ AVFA ND ALGA +AL+ AG+ ++ DG+PD Sbjct: 183 VNAQGSSLGGQRAMQQALLRWPDLAAVFAINDRQALGAEKALRAAGRKQALIGSVDGSPD 242 Query: 245 GEKAVN-DGKLAATIAQLPDQIGAKGVETADKVLKGEKVQAKYPVDLKLVVK 295 E+A+ G++ A+ +Q P IG + V+ ++ G + V + LV + Sbjct: 243 IERALKLSGQIVASASQSPYLIGREAVKLGARLRGGGATTRQVTVPVGLVTR 294 Lambda K H 0.313 0.129 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 313 Length adjustment: 27 Effective length of query: 269 Effective length of database: 286 Effective search space: 76934 Effective search space used: 76934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory