Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_046157384.1 VL52_RS12740 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::O30494 (367 letters) >NCBI__GCF_000971335.1:WP_046157384.1 Length = 370 Score = 324 bits (831), Expect = 2e-93 Identities = 172/357 (48%), Positives = 234/357 (65%), Gaps = 7/357 (1%) Query: 1 MANLKIKNLQKGFEGFS--IIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEG 58 MA L +KN+ K + G +++ I E+ D EFVV VGPSGCGKSTLLR++AGLE +G Sbjct: 1 MAKLSLKNIAKRYPGAERRVLEEISAEIADGEFVVIVGPSGCGKSTLLRMVAGLESTEDG 60 Query: 59 TIELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAA 118 I + R + ++ P RD+AMVFQ YALYPHM+V +NM +AL L G+ K V +V A Sbjct: 61 EIRIGERLVNQLEPKDRDIAMVFQNYALYPHMTVAENMGYALKLKGLKKAEVMERVLRVA 120 Query: 119 RILELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELAR 178 +LEL LL+R+P++LSGGQRQRVA+GRAIVR P +FLFDEPLSNLDA LR QMRLE+ R Sbjct: 121 AVLELEQLLQRRPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRGQMRLEIQR 180 Query: 179 LHKELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPK 238 LH+ L T +YVTHDQVEAMTLAD+V+VLN G IEQ+G+P ++Y +PA FVA F+G+P Sbjct: 181 LHRRLATTSLYVTHDQVEAMTLADRVIVLNKGHIEQIGAPDDIYDRPATAFVAAFMGSPG 240 Query: 239 MGFLKGKVTRVDGQGCEVQLDAGTLISLPLSGASLSVGSAVTLGIRPEHLEIASPGQTTL 298 M + D +G + L G + LP + +L+ G + G+RPEHL A G L Sbjct: 241 MNLFD---AQADARGERLLLGDGVSLPLPAANPALA-GRRLKAGLRPEHLRAAGEGGEAL 296 Query: 299 TVTADVGERLGSDTFCHVITSNGEPLTMRIRGDMASQYGETLHLHLDPAHCHLFDTD 355 ++ D E LG+D + + + + G+ + R+ + G L + + HLFD + Sbjct: 297 SLRVDSVEMLGADNYVYGLLA-GQNVAARLAHGHRPEPGSRLEVTVRAESLHLFDAE 352 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 370 Length adjustment: 30 Effective length of query: 337 Effective length of database: 340 Effective search space: 114580 Effective search space used: 114580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory