Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_046157452.1 VL52_RS13280 ABC transporter ATP-binding protein
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >NCBI__GCF_000971335.1:WP_046157452.1 Length = 361 Score = 239 bits (609), Expect = 1e-67 Identities = 126/287 (43%), Positives = 186/287 (64%), Gaps = 5/287 (1%) Query: 1 MASVTLRNIRKAYDENEVMRDINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGDL 60 MA + ++N+ K + + + D++L + GEF +GPSGCGK+TL+RM+AG E G + Sbjct: 1 MALLEIKNVVKRFGDYTAVNDVSLSVEAGEFFTLLGPSGCGKTTLLRMLAGFEQPDAGQI 60 Query: 61 TIDGMRVNDVAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRNAAKI 120 +DG ++ VAP KR + VFQSYAL+PHMT+ +N+AF LK+A K +I A V + Sbjct: 61 LLDGQDMSQVAPEKRPVHTVFQSYALFPHMTVRENIAFPLKMAKWDKRKIAAQVDELLED 120 Query: 121 LHIDHLLDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMRLEFARLH 180 + + DR P ++SGGQRQRVAI RA+ +P++ L DEPLS LDA LR +M++E L Sbjct: 121 VRLTQFGDRYPHEMSGGQRQRVAIARALVDRPRLLLLDEPLSALDAKLREEMQIELINLQ 180 Query: 181 DELKTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAGFIGSPKMN 240 E+ T +YVTHDQ EA+ L+ +I V+S G +EQ+ +P LY P NRFVA F+G + N Sbjct: 181 KEVGITFVYVTHDQGEALALSHRIAVMSHGKVEQLDAPEKLYSYPKNRFVADFLG--QCN 238 Query: 241 FMEGVVQSVTHDGVTVRYE-TGETQRVAVEPAAVKQGDKVTVGIRPE 286 +EG V+++ D +TV + G+ + AV VK+G + + +RPE Sbjct: 239 VLEGTVKALHGDAMTVALKGCGDVKCQAV--PGVKEGQQGWLALRPE 283 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 361 Length adjustment: 30 Effective length of query: 339 Effective length of database: 331 Effective search space: 112209 Effective search space used: 112209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory