Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_046156772.1 VL52_RS09315 sulfate ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000971335.1:WP_046156772.1 Length = 356 Score = 216 bits (549), Expect = 1e-60 Identities = 134/326 (41%), Positives = 188/326 (57%), Gaps = 28/326 (8%) Query: 20 LHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPARERNVA 79 L + L+ GE V LLGPSGCGK+T+LR+IAGLE G + + G + RER V Sbjct: 18 LDDVSLNFPGGELVALLGPSGCGKTTLLRIIAGLEQADAGRVLLDGQDASATHVRERQVG 77 Query: 80 MVFQNYALYPHMSVYDNIAFGLR---RLKRPA-AEIDRRVREVAALLNLEALLERKPRAM 135 VFQ+YAL+ HMSV+DN+AFGLR R +RP+ AEI R+V + L+ L+ L +R P + Sbjct: 78 FVFQHYALFRHMSVFDNVAFGLRMKPRRERPSEAEIARKVHALLDLVQLDWLADRLPAQL 137 Query: 136 SGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQ 195 SGGQ+QR A+ARA+ P V L DEP LDAK+R +LR +++LH L T+++VTHDQ Sbjct: 138 SGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRKLHDELHITSIFVTHDQ 197 Query: 196 LEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNFLSGTVQRQDGQLF 255 EA+ +ADRV+LM G++ Q GSPAE+Y P + F GF+G + N + G Sbjct: 198 EEALEVADRVVLMNHGKVEQIGSPAEVYGQPASAFVYGFLG--SANRVRGV--------- 246 Query: 256 IETAHQRWALTGERFS---RLRHAMAVKLAVRPDHVRIAGEREPAASLTCPVSVELVEIL 312 +A A+ G+ + +L H V+ +RP + I P P V+ V L Sbjct: 247 --SAAGAVAVGGQTLAADHQLPHGQPVEAFIRPHELAIL----PEHGAGLPARVQRVLTL 300 Query: 313 GADALLTTRCGD----QTLTALVPAD 334 G + + D Q+ A +PAD Sbjct: 301 GGLSRIELEGRDELAGQSFDAELPAD 326 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 356 Length adjustment: 30 Effective length of query: 376 Effective length of database: 326 Effective search space: 122576 Effective search space used: 122576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory