Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_046560312.1 TQ33_RS00415 D-2-hydroxyacid dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >NCBI__GCF_000981765.1:WP_046560312.1 Length = 315 Score = 130 bits (327), Expect = 4e-35 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 24/286 (8%) Query: 35 ETTVEKAKGAQVVSLFVSDKA--DGPVLEALHSYGVGLLALRSAGYDHIDIETAKRLGIK 92 E +E+ K A VV +++K DG L+ L V + L + G ++ID+E AK L IK Sbjct: 44 EEVLERCKDADVV---ITNKVVLDGETLKQLPQLKV--IQLAATGMNNIDLEAAKELDIK 98 Query: 93 VVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLGD------FDLDGLMGFDLNGKVA 146 NV YS A+A TL ML R + G F L +L GK Sbjct: 99 CFNVADYSTFAVAQLTLQFMLNFATRACEHYQLTAQGAWQKSRMFTLTDFPIMELEGKTL 158 Query: 147 GVIGLGKIGRLVATRLKAFGCKVLGYDPYIQPEIVENVDLDTLITQADIISIHCPLTREN 206 +IG G IG+ V +AFG KV+ + +P V LD + QAD +S+HCPLT E Sbjct: 159 ALIGYGNIGKKVEQLAQAFGMKVIVANIPGRPMRDNQVTLDEALPQADFVSLHCPLTDET 218 Query: 207 FHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKLGGAALDVYEYERGLFFKNH 266 + N++ F +MK A ++NTARG +I+ + L ALK+ + GA LDV E Sbjct: 219 KDLLNKDFFHQMKSTAYVINTARGPVINEQDLAIALKNKVIAGAGLDVLSVE-------- 270 Query: 267 QKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNIEETTVENILE 312 + +P LA + N+ +T H A+ + EA + + + +N+ E Sbjct: 271 -PPSLNNPLLAS--DIPNIAITPHIAWASHEAKQRLIQGMADNMKE 313 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 315 Length adjustment: 28 Effective length of query: 297 Effective length of database: 287 Effective search space: 85239 Effective search space used: 85239 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory