Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_047007780.1 AAW01_RS12520 ATP-binding cassette domain-containing protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_001010925.1:WP_047007780.1 Length = 208 Score = 113 bits (282), Expect = 5e-30 Identities = 66/174 (37%), Positives = 102/174 (58%), Gaps = 3/174 (1%) Query: 38 VLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEAV-SSPRRVMMSPEKRGIAMVFQNWALY 96 ++GPSG GKT+ L IAGL +P G++ + + R + + PEKR VFQ+ L+ Sbjct: 29 LVGPSGVGKTSALNAIAGLAKPLQGHVNVAGQRMFDEARGIDLPPEKRRAGYVFQDTRLF 88 Query: 97 PNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARA 156 P+ TV N+AF K + + I++ E L + +LNRYP LSGG+ +R AI RA Sbjct: 89 PHRTVAANLAFAGKFSDRTQAPIDHD--ETVRLLEIGHLLNRYPANLSGGEARRVAIGRA 146 Query: 157 LVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTLIVSHDPADIFAIA 210 L+ P+ LLLDEP ++LD E+ AL+ +++ L ++VSH A++ +A Sbjct: 147 LLSAPRFLLLDEPAASLDPARAEALLALIERLRDTIDLPIMLVSHSAAEVERLA 200 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 208 Length adjustment: 25 Effective length of query: 346 Effective length of database: 183 Effective search space: 63318 Effective search space used: 63318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory